Mouse Anti-zbtb21 Antibody (CBMOAB-16667FYB)


Cat: CBMOAB-16667FYB
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-16667FYB Monoclonal Zebrafish (Danio rerio), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Marmoset WB, ELISA MO16667FYB 100 µg
MO-AB-16046W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO16046W 100 µg
MO-AB-23109R Monoclonal Cattle (Bos taurus) WB, ELISA MO23109R 100 µg
MO-AB-68100W Monoclonal Marmoset WB, ELISA MO68100W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Marmoset
CloneMO16667FYB
SpecificityThis antibody binds to Zebrafish zbtb21.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Zebrafish zbtb21 Antibody is a mouse antibody against zbtb21. It can be used for zbtb21 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative Nameszbtb21; znf295; Zinc Finger And BTB Domain Containing 21
UniProt IDF1QC37
Protein RefseqThe length of the protein is 164 amino acids long.
The sequence is show below: XNTRWMESRLLHAQRNSETKSSVGAPRRPKPPRQAKMESLGHYCNPAHGISLLGSLNEQRLKGQLCDVVLLVGDQQYQAHKSILAACSEYFQSVFSRRDSENRSIVQLDFCEPDAFEIVLNYIYSSSLFVEKCSLAAIQELGYSLGIPFLTNIMSVRPQASYCV.
For Research Use Only | Not For Clinical Use.
Online Inquiry