AibGenesis™ Mouse Anti-ZC3HAV1 Antibody (CBMOAB-62713FYA)


Cat: CBMOAB-62713FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-62713FYA Monoclonal Rhesus (Macaca mulatta), Chimpanzee (Pan troglodytes), Marmoset WB, ELISA MO62713FYA 100 µg
MO-AB-07005W Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO07005W 100 µg
MO-AB-11459W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO11459W 100 µg
MO-AB-68155W Monoclonal Marmoset WB, ELISA MO68155W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Chimpanzee (Pan troglodytes), Marmoset
CloneMO62713FYA
SpecificityThis antibody binds to Rhesus ZC3HAV1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a CCCH-type zinc finger protein that is thought to prevent infection by retroviruses. Studies of the rat homolog indicate that the protein may primarily function to inhibit viral gene expression and induce an innate immunity to viral infection. Alternative splicing occurs at this locus and two variants, each encoding distinct isoforms, are described. (From NCBI)
Product OverviewMouse Anti-Rhesus ZC3HAV1 Antibody is a mouse antibody against ZC3HAV1. It can be used for ZC3HAV1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesZC3HAV1
UniProt IDF7HRZ2
Protein RefseqThe length of the protein is 161 amino acids long.
The sequence is show below: MFIGETWTDFKPMEMIEEAYSDPRIHVCSVGSYTINFREMSCDFIPIRRLSTPSSVTKPANSVFTTKWIWYWKNESGTWIQYGEEVSTAKAGESSEVRSLRPAWPTWIQSFSRTDLDYFIYFFLSKGMIQTNKASKTQKDVIRRPKFVSQWDVQQMKRGPE.
For Research Use Only | Not For Clinical Use.
Online Inquiry