AibGenesis™ Mouse Anti-ZCWPW2 Antibody (CBMOAB-62748FYA)


Cat: CBMOAB-62748FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-62748FYA Monoclonal Rhesus (Macaca mulatta), Chimpanzee (Pan troglodytes) WB, ELISA MO62748FYA 100 µg
MO-AB-14933W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO14933W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Chimpanzee (Pan troglodytes)
CloneMO62748FYA
SpecificityThis antibody binds to Rhesus ZCWPW2.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionZCWPW2, a protein containing the CW-type zinc finger and PWWP domain (Pro-Trp-Trp-Pro), functions as an epigenetic regulator. It is hypothesized to participate in DNA damage repair, meiotic recombination, or gene transcription regulation through interactions with methylated histones or chromatin remodeling complexes.
Product OverviewMouse Anti-Rhesus ZCWPW2 Antibody is a mouse antibody against ZCWPW2. It can be used for ZCWPW2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesZCWPW2
UniProt IDF7GD85
Protein RefseqThe length of the protein is 356 amino acids long.
The sequence is show below: MDKEKLDGKIDYCNCAMDSSVENMYVNKVWVQCENENCLKWRLLSSEDAAKVDHDEPWYCFMNTDSRYNNCSISEEDFPEESQLHQCGFKIVYSQLPLGSLVLVKLQNWPSWPGILCPDRFKGKYVTYDPDGNVEEYHIEFLGDPHSRSWIKATFVGHYSITLKPEKCKNKKKWYKSALQEAYLLYGYSHEQRLEMCCLSKQQDKSKTYDKVAVLAKKGKQISKNNIEKKKPKLRKRKRKAILKCAFENVCSDDALSKENMVVSETEVLLKELEQMLQQALQPTVTPDESEEGYGEEINTGEKLSKCSPEAPAGNLFENHCEEDYLVIDGIKLKAGECIEDITNKFKEIDALMSEF.
For Research Use Only | Not For Clinical Use.
Online Inquiry