AibGenesis™ Mouse Anti-ZDHHC12 Antibody (CBMOAB-62753FYA)
Cat: CBMOAB-62753FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
| Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
| CBMOAB-62753FYA | Monoclonal | Rhesus (Macaca mulatta), Cat (Felis catus), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Dog (Canis lupus familiaris), Elephant (Loxodonta africana), Ferret (Mustela Putorius Furo), Guinea pig (Cavia porcellus), Horse (Equus caballus), Mallard (Anas platyrhynchos), Marmoset, Medaka (Oryzias latipes), Nile tilapia (Oreochromis niloticus), O. anatinus (Ornithorhynchus anatinus), Sheep (Ovis aries) | WB, ELISA | MO62753FYA | 100 µg | ||
| MO-AB-01718L | Monoclonal | Elephant (Loxodonta africana) | WB, ELISA | MO01718L | 100 µg | ||
| MO-AB-01956R | Monoclonal | Medaka (Oryzias latipes) | WB, ELISA | MO01956R | 100 µg | ||
| MO-AB-07019Y | Monoclonal | O. anatinus (Ornithorhynchus anatinus) | WB, ELISA | MO07019Y | 100 µg | ||
| MO-AB-08030W | Monoclonal | Cat (Felis catus) | WB, ELISA | MO08030W | 100 µg | ||
| MO-AB-13125W | Monoclonal | Chimpanzee (Pan troglodytes) | WB, ELISA | MO13125W | 100 µg | ||
| MO-AB-18308Y | Monoclonal | Sheep (Ovis aries) | WB, ELISA | MO18308Y | 100 µg | ||
| MO-AB-23150R | Monoclonal | Cattle (Bos taurus) | WB, ELISA | MO23150R | 100 µg | ||
| MO-AB-23904H | Monoclonal | Mallard (Anas platyrhynchos) | WB, ELISA | MO23904C | 100 µg | ||
| MO-AB-34054H | Monoclonal | Nile tilapia (Oreochromis niloticus) | WB, ELISA | MO34054C | 100 µg | ||
| MO-AB-34111W | Monoclonal | Dog (Canis lupus familiaris) | WB, ELISA | MO34111W | 100 µg | ||
| MO-AB-36016W | Monoclonal | Ferret (Mustela Putorius Furo) | WB, ELISA | MO36016W | 100 µg | ||
| MO-AB-42871W | Monoclonal | Guinea pig (Cavia porcellus) | WB, ELISA | MO42871W | 100 µg | ||
| MO-AB-47118W | Monoclonal | Horse (Equus caballus) | WB, ELISA | MO47118W | 100 µg | ||
| MO-AB-68174W | Monoclonal | Marmoset | WB, ELISA | MO68174W | 100 µg |
Specifications
| Host species | Mouse (Mus musculus) |
| Species Reactivity | Rhesus (Macaca mulatta), Cat (Felis catus), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Dog (Canis lupus familiaris), Elephant (Loxodonta africana), Ferret (Mustela Putorius Furo), Guinea pig (Cavia porcellus), Horse (Equus caballus), Mallard (Anas platyrhynchos), Marmoset, Medaka (Oryzias latipes), Nile tilapia (Oreochromis niloticus), O. anatinus (Ornithorhynchus anatinus), Sheep (Ovis aries) |
| Clone | MO62753FYA |
| Specificity | This antibody binds to Rhesus ZDHHC12. |
| Format | Liquid or Lyophilized |
| Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
| Purity | > 90% was determined by SDS-PAGE |
| Purification | Purified with Protein A or G affinity chromatography |
Application Information
| Application | WB, ELISA |
| Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
| Introduction | Putative palmitoyltransferase. (From uniprot, under CC BY 4.0) |
| Product Overview | Mouse Anti-Rhesus ZDHHC12 Antibody is a mouse antibody against ZDHHC12. It can be used for ZDHHC12 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
| Alternative Names | Putative palmitoyltransferase ZDHHC12; ZDHHC12 |
| UniProt ID | H9FED7 |
| Protein Refseq | The length of the protein is 102 amino acids long. The sequence is show below: HPLFVVYLALQLVVLLWGLYLAWSGLQFFQPWGLWLRSSGLLFATFLLLSLLSLVASLLLASHLYLVASNTTTWEFISSHRIAYLRQRPGNPFDRGLTRNLA. |
For Research Use Only | Not For Clinical Use.
Online Inquiry