Mouse Anti-Zebrafish abcg1 Antibody (CBMOAB-64413FYA)


Cat: CBMOAB-64413FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio)
CloneMO64413FYA
SpecificityThis antibody binds to Zebrafish abcg1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationPlasma Membrane; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThe protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White). This protein is a member of the White subfamily. It is involved in macrophage cholesterol and phospholipids transport, and may regulate cellular lipid homeostasis in other cell types. Six alternative splice variants have been identified.
Product OverviewMouse Anti-Zebrafish abcg1 Antibody is a mouse antibody against abcg1. It can be used for abcg1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative Namesabcg1; ATP Binding Cassette Subfamily G Member 1
UniProt IDF1RDP4
Protein RefseqThe length of the protein is 673 amino acids long.
The sequence is show below: MACLMAAFSFNNTTVTNSIIMNTNGPPDLMLDPRTVCVSIDEMMSNHVSSQQTPLLHAHLKKVENNLTEAQRFSYLPRRPAVNIEFKDLSYSVPEGPWWRKKGYKTLLKGISGNFTGGALVAIMGPSGAGKSTLMNILAGYRETGMKGEILINGHPRDLRSFRKVSCYIMQDDMLLPHLTVQEAMMVSANLKLQEKDEGRREMVREILTALGLLECAKTRTSHLSGGQRKRLAIALELVNNPPVMFFDEPTSGLDSSSCFQVVSLMKALAQGGRTVICTIHQPSAKVFELFDKLYVLSQGQCIYRGKVSSLIPYLRDLGLSCPTYHNPADFIMEVASGEYGDQTARLVKAVQEHKCEKDYKTEMNGNGVHNPFLWHRPSDEDSSSSEGCHSFSASCLTQFCILFKRTFLSIMRDSVLTHLRIMSHLGIGILIGLLYLGIGNEAKKVLSNSGFLFFSMLFLMFAALMPTVLTFPLEMGVFLREHLNYWYSLKAYYLAKTMADVPFQIVFPVAYCSIVYWMTSQPSDAVRFILFLALGTLTSLVAQSLGLLIGAASTSLQVATFVGPVTAIPVLLFSGFFVSFDTIPKYLQWISYISYVRYGFEGVILSIYGLDREDLHCDKDETCHFQKSEAILKELDVEDAKLYMDFIVLGIFFISLRLIAYFVLRYKISAER.
For Research Use Only | Not For Clinical Use.
Online Inquiry