AibGenesis™ Mouse Anti-Zebrafish abhd2b Antibody (CBMOAB-64465FYA)


Cat: CBMOAB-64465FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Specifications
  • Application Information
  • Target

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio)
CloneMO64465FYA
SpecificityThis antibody binds to Zebrafish abhd2b.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationPlasma Membrane; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionProgesterone-dependent acylglycerol lipase that catalyzes hydrolysis of endocannabinoid arachidonoylglycerol (AG) from cell membrane. Acts as a progesterone receptor: progesterone-binding activates the acylglycerol lipase activity, mediating degradation of 1-arachidonoylglycerol (1AG) and 2-arachidonoylglycerol (2AG) to glycerol and arachidonic acid (AA). Also displays an ester hydrolase activity against acetyl ester, butanoate ester and hexadecanoate ester. Plays a key role in sperm capacitation in response to progesterone by mediating degradation of 2AG, an inhibitor of the sperm calcium channel CatSper, leading to calcium influx via CatSper and sperm activation. May also play a role in smooth muscle cells migration. (From uniprot, under CC BY 4.0)
Product OverviewMouse Anti-Zebrafish abhd2b Antibody is a mouse antibody against abhd2b. It can be used for abhd2b detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesAbhydrolase domain-containing protein 2-B; EC 3.1.1.-; abhd2
UniProt IDQ05AK6
Protein RefseqThe length of the protein is 422 amino acids long.
The sequence is show below: MSAQLEADVRTMSPEMPAMFDGMKLAAVAAVLYVIVRSLNLKCPTAAADITCQDTLLNHYLLKSCPVLTKEYIPPLLWGKSGHLQTALYGKIGRVKSPKPCGLRKFLPMQDGATATFDLFEPQGVHSTGDDITMVICPGIGNHSEKHYIRTFVDYSQKQGYRCAVLNHLGALPNIELTSPRMFTYGCTWEFSAMVGFIKRTFPQTQLIVVGFSLGGNIACKYLGENPANQERVLCCVSVCQGYSALRAQETFLQWDQCRRLYNFLMADNMKKIILSHRGSLFGMNSSRMEFADLSRLYTATSLMQIDDNIMRKFHGHNSLKEYYEKESCVHYIHNISVPLLLVNSSDDPLVHQSLLTIPRTLAEKKQNVIFALTLHGGHLGFFEGAVLFPQPLSWMDKVIVSYANAVCQWEKHKPQCHQQKE.
For Research Use Only | Not For Clinical Use.
Online Inquiry