Mouse Anti-Zebrafish acyp1 Antibody (CBMOAB-64850FYA)


Cat: CBMOAB-64850FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio)
CloneMO64850FYA
SpecificityThis antibody binds to Zebrafish acyp1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene is a member of the acylphosphatase family. The encoded protein is a small cytosolic enzyme that catalyzes the hydrolysis of the carboxyl-phosphate bond of acylphosphates. Two isoenzymes have been isolated and described based on their tissue localization: erythrocyte (common) type acylphosphatase encoded by this gene, and muscle type acylphosphatase. Alternative splicing results in multiple transcript variants.
Product OverviewMouse Anti-Zebrafish acyp1 Antibody is a mouse antibody against acyp1. It can be used for acyp1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative Namesacyp1; Acylphosphatase 1
UniProt IDF8W530
Protein RefseqThe length of the protein is 124 amino acids long.
The sequence is show below: MRCTAECRGFSFANTHRLKGRGWVWLAGFRTLMLEPFKGSSRVPSLKSSRCSNGSKPPAAQSPASPKQSSRMNTPSTNWSLRISKLSANQRAEQLVFINIGKVYILFILAFKNLHDYLFMIVNM.
For Research Use Only | Not For Clinical Use.
Online Inquiry