AibGenesis™ Mouse Anti-adamtsl2 Antibody (CBMOAB-64915FYA)


Cat: CBMOAB-64915FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-64915FYA Monoclonal Zebrafish (Danio rerio), Dog (Canis lupus familiaris) WB, ELISA MO64915FYA 100 µg
MO-AB-28827W Monoclonal Dog (Canis lupus familiaris) WB, ELISA MO28827W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio), Dog (Canis lupus familiaris)
CloneMO64915FYA
SpecificityThis antibody binds to Zebrafish adamtsl2.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a member of the ADAMTS (a disintegrin and metalloproteinase with thrombospondin motifs) and ADAMTS-like protein family. Members of the family share several distinct protein modules, including a propeptide region, a metalloproteinase domain, a disintegrin-like domain, and a thrombospondin type 1 (TS) motif. Individual members of this family differ in the number of C-terminal TS motifs, and some have unique C-terminal domains. The protein encoded by this gene lacks the protease domain, and is therefore of a member of the the ADAMTS-like protein subfamily. It is a secreted glycoprotein that binds the cell surface and extracellular matrix; it also interacts with latent transforming growth factor beta binding protein 1. Mutations in this gene have been associated with geleophysic dysplasia. (From NCBI)
Product OverviewMouse Anti-Zebrafish adamtsl2 Antibody is a mouse antibody against adamtsl2. It can be used for adamtsl2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative Namesadamtsl2; ADAMTS Like 2
UniProt IDF1RC76
Protein RefseqThe length of the protein is 617 amino acids long.
The sequence is show below: QPIGCDGVLFSPNTLDKCGVCQGDGSSCSRVTGNFRRGASSLGYTFITQIPEGSWDIQVIERKKSADILAVTDQAGNFFFNGAYKMDTPQNFHAAGTIFKYRRPTDVYETGIEYIVAKGPIDQPINVLVWNQNGQNPYITYEYTVMRDSMASVSQPPIYTGPQGGSSLVSVEVVSVLQHNQSMFSETFKEHRGETAKQKLAGLHSIIFIIHAGFPPLRPNTALPAPLPETINKSRRYRWKLSTQEPCSMTCSIGVSKSLAMCVRYDGIEVDDVYCDALTRPEPVHDFCIGRECQPRWEASSWSECSRTCGEGFQFRLVRCWKMLAPGLDSSVYSDLCTEAQLERPPERRACKSPTCGPQWEVAEWSECPAKCGRKSLVTREVRCSDEAHACDEETRPPSTKNCTGPPCERQWTASEWGPCSGICGHGKTVRHVYCKTAEGRVVPESQCSPENKPLAIHPCGDNECAPHWLAQDWERCNTTCGRGVKRRTVLCVSITSGKVQINEDEECDASKRPADEDTCFERPCFKWYTTPWSECTKTCGVGVRMRDVKCYQGRELVRGCDPLTKPVNKQTCALQPCPTEPPDENCQDRPTTNCSLALKVNLCSHWYYSKACCHSC.
For Research Use Only | Not For Clinical Use.
Online Inquiry