AibGenesis™ Mouse Anti-adck1 Antibody (CBMOAB-64945FYA)


Cat: CBMOAB-64945FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-64945FYA Monoclonal Zebrafish (Danio rerio), Cattle (Bos taurus), Chicken (Gallus gallus), Chimpanzee (Pan troglodytes), Marmoset, Pig (Sus scrofa) WB, ELISA MO64945FYA 100 µg
MO-AB-00052Y Monoclonal Chicken (Gallus gallus) WB, ELISA MO00052Y 100 µg
MO-AB-07011R Monoclonal Cattle (Bos taurus) WB, ELISA MO07011R 100 µg
MO-AB-13366W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO13366W 100 µg
MO-AB-23539R Monoclonal Pig (Sus scrofa) WB, ELISA MO23539R 100 µg
MO-AB-50461W Monoclonal Marmoset WB, ELISA MO50461W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio), Cattle (Bos taurus), Chicken (Gallus gallus), Chimpanzee (Pan troglodytes), Marmoset, Pig (Sus scrofa)
CloneMO64945FYA
SpecificityThis antibody binds to Zebrafish adck1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Zebrafish adck1 Antibody is a mouse antibody against adck1. It can be used for adck1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesZgc:175225 protein; adck1; zgc:17522
UniProt IDB1H1M5
Protein RefseqThe length of the protein is 521 amino acids long.
The sequence is show below: MAVRLLKVSSVATAVFASSGFYLYSKNVDYNDLSIVRFGRAAATTAVISYDYLTTLRDVQYGTEEYWAVKSKVHRRSAERLLDLCCANRGTFIKVGQHLGALEYLLPEEYTSTLKILHSRAPHSSMEHIRQVIREDLGKELSDLFIQFDETPHGAASLAQVHKAVLPDGRTVAVKVQHPKVQRQSSKDIVVMEFLLQVVHWLFPDFAFMWLVEEAKKNMPLELDFLNEGRNAEKIADMLKQFSFLKIPKIHWDLSTKRILTMDFAEGGQVNDREYMRRHGINVNEISRNLGKIYSEMIFVNGFVHCDPHPGNVLVRKSPESNKTEIVLLDHGLYQVLNQDFRLDYCRLWQSLIKGDLKGIERYSRRLGAGDLYPLFACVLTARSWTSVNAGISQTPVTQSEDVEIRTNAALYLPQISELLNRIPRQMLLLLKTNDLLRGIETILQTRASSSSFINMSRCCTRAVARHKRSKASSRSRRVRIWLSERWSLCQINLYELVLWLRSSALARCLCYLLNCLPHTN.
For Research Use Only | Not For Clinical Use.
Online Inquiry