Mouse Anti-Zebrafish adrb1 Antibody (CBMOAB-65099FYA)


Cat: CBMOAB-65099FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio)
CloneMO65099FYA
SpecificityThis antibody binds to Zebrafish adrb1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationPlasma Membrane

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThe adrenergic receptors (subtypes alpha 1, alpha 2, beta 1, and beta 2) are a prototypic family of guanine nucleotide binding regulatory protein-coupled receptors that mediate the physiological effects of the hormone epinephrine and the neurotransmitter norepinephrine. Specific polymorphisms in this gene have been shown to affect the resting heart rate and can be involved in heart failure.
Product OverviewMouse Anti-Zebrafish adrb1 Antibody is a mouse antibody against adrb1. It can be used for adrb1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesBeta-1-adrenergic receptor; adrb
UniProt IDI7GPQ6
Protein RefseqThe length of the protein is 390 amino acids long.
The sequence is show below: MGDGLPSVNYSNDSKRATVDLNVSEQWLVGMGILMGLIVFVIVVGNILVIVAIARNQRLQTLTNVFIVSLACADLIMGLLVVPFGAALEVRGTWMYGSFFCEFWISLDVLCVTASIETLCVIAIDRYIAIISPFRYQSLLTKARAKVVVCAVWAISALVSFPPILMHWSQDSEETSCYENPECCDFVTNRAYAISSSIISFYIPLIVMIFVYARVYREAKQQLNKINKCEGRFYNNHGTNCKPTRKRTTKILALKEQKALKTLGIIMGTFTLCWLPFFIVNVVRVFCAQVVDKELFVFLNWLGYVNSAFNPIIYCRSPDFRKAFKRLLCCPRQADRRLHVSSCDLSRCTGGFGNSMEQSMLGTWSDCNGADSSDCSLERNGRMSHSESQL.
See other products for " ADRB1 "
MO-AB-41188WMouse Anti-Guinea pig ADRB1 Antibody (MO-AB-41188W)
MO-AB-23588RMouse Anti-Pig ADRB1 Antibody (MO-AB-23588R)
MO-AB-14106YMouse Anti-Sheep ADRB1 Antibody (MO-AB-14106Y)
MO-AB-07081RMouse Anti-Cattle ADRB1 Antibody (MO-AB-07081R)
CBMOAB-35267FYAMouse Anti-Rhesus ADRB1 Antibody (CBMOAB-35267FYA)
MO-AB-28854WMouse Anti-Dog ADRB1 Antibody (MO-AB-28854W)
MO-AB-08412WMouse Anti-Cat ADRB1 Antibody (MO-AB-08412W)
For Research Use Only | Not For Clinical Use.
Online Inquiry