Mouse Anti-Zebrafish ak3 Antibody (CBMOAB-65345FYA)


Cat: CBMOAB-65345FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio)
CloneMO65345FYA
SpecificityThis antibody binds to Zebrafish ak3.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationMitochondrion

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThe protein encoded by this gene is a GTP:ATP phosphotransferase that is found in the mitochondrial matrix. Several transcript variants encoding a few different isoforms have been found for this gene.
Product OverviewMouse Anti-Zebrafish ak3 Antibody is a mouse antibody against ak3. It can be used for ak3 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesGTP:AMP phosphotransferase AK3, mitochondrial; EC 2.7.4.10; Adenylate kinase 3; ak
UniProt IDF1R4S7
Protein RefseqThe length of the protein is 225 amino acids long.
The sequence is show below: MGLQSVFRAVIMGAPGSGKGTVSSRIAQSFGLKHLSSGDMLRANIEAKTDLGLLMKSCIDQGQLVPDDVISRLILSSLRGLEKTSWLLDGFPRTVAQAEALDCVYDVDSVINLDVPFQTIRERLTSRWVHLPSGRVYNIDFNPPKKPGLDDVTGEPLVQRDDDSPETVSRRLKDYERQTQPVLEYYRSKGVLETFSGTETNKIWPHVHTFLSRKIPGHKQAMGKA.
See other products for " AK3 "
MO-AB-23651RMouse Anti-Pig AK3 Antibody (MO-AB-23651R)
MO-AB-07175RMouse Anti-Cattle AK3 Antibody (MO-AB-07175R)
MO-AB-00036RMouse Anti-Medaka AK3 Antibody (MO-AB-00036R)
MO-AB-32817HMouse Anti-Nile tilapia AK3 Antibody (MO-AB-32817H)
MO-AB-07133YMouse Anti-Rabbit AK3 Antibody (MO-AB-07133Y)
MO-AB-41203WMouse Anti-Guinea pig AK3 Antibody (MO-AB-41203W)
MO-AB-01320HMouse Anti-Frog ak3 Antibody (MO-AB-01320H)
MO-AB-14149YMouse Anti-Sheep AK3 Antibody (MO-AB-14149Y)
MO-AB-08416WMouse Anti-Cat AK3 Antibody (MO-AB-08416W)
MO-AB-34356WMouse Anti-Ferret AK3 Antibody (MO-AB-34356W)
For Research Use Only | Not For Clinical Use.
Online Inquiry