Mouse Anti-Zebrafish akr1b1 Antibody (CBMOAB-65411FYA)


Cat: CBMOAB-65411FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio)
CloneMO65411FYA
SpecificityThis antibody binds to Zebrafish akr1b1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationCytosol

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a member of the aldo/keto reductase superfamily, which consists of more than 40 known enzymes and proteins. This member catalyzes the reduction of a number of aldehydes, including the aldehyde form of glucose, and is thereby implicated in the development of diabetic complications by catalyzing the reduction of glucose to sorbitol. Multiple pseudogenes have been identified for this gene. The nomenclature system used by the HUGO Gene Nomenclature Committee to define human aldo-keto reductase family members is known to differ from that used by the Mouse Genome Informatics database.
Product OverviewMouse Anti-Zebrafish akr1b1 Antibody is a mouse antibody against akr1b1. It can be used for akr1b1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesZgc:86611; akr1b1; zgc:8661
UniProt IDQ6IQU1
Protein RefseqThe length of the protein is 315 amino acids long.
The sequence is show below: MTSVTLNNGAKMPIVGLGTWRSPPGEVTEAVKSAILSGYRHIDGAHVYENENEVGDGICAMINQGVVKREDLFIVSKLWCTFHEKHLVRGACEKTLSDLKLDYVDLYLMHFPMGTKPGKDLFPLDKDGHVIPDNSNFLETWEAMEELVDAGLVKAIGISNFNRDQIEAILNKPGLKYKPANNQIECHPYLTQEKLINYCQSKGITVTAYSPLGSPNRPWAQADEPSLLEDPKIKAIADKHGKTTAQVLIHFHIQRNVVVIPKSVTPSRIKENFEVFDFELSKEEMNTILSFNRNFRAFGLEWASKHKDFPLNAEY.
For Research Use Only | Not For Clinical Use.
Online Inquiry