AibGenesis™ Mouse Anti-anapc15 Antibody (CBMOAB-65691FYA)


Cat: CBMOAB-65691FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-65691FYA Monoclonal Zebrafish (Danio rerio), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Marmoset, Rat (Rattus norvegicus) WB, ELISA MO65691FYA 100 µg
MO-AB-07327R Monoclonal Cattle (Bos taurus) WB, ELISA MO07327R 100 µg
MO-AB-24059H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO24059C 100 µg
MO-AB-24877W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO24877W 100 µg
MO-AB-50813W Monoclonal Marmoset WB, ELISA MO50813W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Marmoset, Rat (Rattus norvegicus)
CloneMO65691FYA
SpecificityThis antibody binds to Zebrafish anapc15.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationNucleus

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Zebrafish anapc15 Antibody is a mouse antibody against anapc15. It can be used for anapc15 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesAnaphase-promoting complex subunit 15; APC15; anapc1
UniProt IDF1QY75
Protein RefseqThe length of the protein is 121 amino acids long.
The sequence is show below: MSALFPSLFPRVTESLWFNLDRPCVDEAELNQQEQQHQTWLQSIVEKDNNLMPIGRPIFETFDEEEEEDDEDEEDSEEDSEDDEDMQDMDDMNIYNEFPDDGEINEVDMEGADQDQDQWMI.
For Research Use Only | Not For Clinical Use.
Online Inquiry