Mouse Anti-Zebrafish apoeb Antibody (CBMOAB-66177FYA)


Cat: CBMOAB-66177FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio)
CloneMO66177FYA
SpecificityThis antibody binds to Zebrafish apoeb.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationExtracellular region or secreted

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionAPOE is an apolipoprotein, a protein associating with lipid particles, that mainly functions in lipoprotein-mediated lipid transport between organs via the plasma and interstitial fluids. APOE is a core component of plasma lipoproteins and is involved in their production, conversion and clearance. Apoliproteins are amphipathic molecules that interact both with lipids of the lipoprotein particle core and the aqueous environment of the plasma.
Product OverviewMouse Anti-Zebrafish apoeb Antibody is a mouse antibody against apoeb. It can be used for apoeb detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesApolipoprotein Eb; Apo-Eb; apoeb; apoe; NP_571173.
UniProt IDO42364
Protein RefseqThe length of the protein is 281 amino acids long.
The sequence is show below: MRSLVVFFALAVLTGCQARSLFQADAPQPRWEEMVDRFWQYVSELNTQTDGMVQNIKGSQLSRELDTLITDTMAELSSYSENLQTQMTPYASDAAGQLSKDLQLLAGKLQTDMTDAKERSTQYLQELKTMMEQNADDVKNRVGTYTRKLKKRLNKDTEEIRNTVATYMSEMQSRASQNADAVKDRFQPYMSQAQDGATQKLGAISELMKAQAQEVSEQLEVQAGALKEKLEETAENLRTSLEGRVDELTSLLAPYSQKIREQLQEVMDKIKEATAALPTQA.
For Research Use Only | Not For Clinical Use.
Online Inquiry