Mouse Anti-Zebrafish aqp7 Antibody (CBMOAB-66243FYA)


Cat: CBMOAB-66243FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio)
CloneMO66243FYA
SpecificityThis antibody binds to Zebrafish aqp7.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a member of the aquaporin family of water-selective membrane channels. The encoded protein localizes to the plasma membrane and allows movement of water, glycerol and urea across cell membranes. This gene is highly expressed in the adipose tissue where the encoded protein facilitates efflux of glycerol. In the proximal straight tubules of kidney, the encoded protein is localized to the apical membrane and prevents excretion of glycerol into urine. The encoded protein is present in spermatids, as well as in the testicular and epididymal spermatozoa suggesting an important role in late spermatogenesis. Alternative splicing of this gene results in multiple transcript variants encoding different isoforms. This gene is located adjacent to a related aquaporin gene on chromosome 9. Multiple pseudogenes of this gene have been identified.
Product OverviewMouse Anti-Zebrafish aqp7 Antibody is a mouse antibody against aqp7. It can be used for aqp7 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative Namesaqp7; Aquaporin 7
UniProt IDF1QYN2
Protein RefseqThe length of the protein is 336 amino acids long.
The sequence is show below: FNSHQCNYSKSLNDQAGREESSAEKEVKQEVSIMEDGSIQGRMAPNVGSMLKIKNEYIRVALAESLCTFIMMVFGLGTVAQVVTGEGYFGEYLSINIGFGLAVAMGVHVGGKVSGAHMNAAVSFTMCVFGRLRWKMLPLYVFAQFLGSFLAAGTIFSLYYDAINHFCGGNLTVSGPKATAGIFATYPAPYISVYTGFFDQVAGTGLLLLCLMALSDQRNQPLVSGGEAVGVGLLVMLIGVSMGSNSGYAINPTRDLGPRLFTLMAGWGTEVFRAGNCWWWVPLVAPFIGGVLGALIYKALVELHHPDLKSTITRPAVDPECIPLDKCKNGRIEIPV.
For Research Use Only | Not For Clinical Use.
Online Inquiry