AibGenesis™ Mouse Anti-arl10 Antibody (CBMOAB-66492FYA)


Cat: CBMOAB-66492FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-66492FYA Monoclonal Zebrafish (Danio rerio), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Marmoset, Rat (Rattus norvegicus) WB, ELISA MO66492FYA 100 µg
MO-AB-01576H Monoclonal Frog (Xenopus laevis) WB, ELISA MO01576C 100 µg
MO-AB-07584R Monoclonal Cattle (Bos taurus) WB, ELISA MO07584R 100 µg
MO-AB-13066W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO13066W 100 µg
MO-AB-24150H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO24150C 100 µg
MO-AB-51276W Monoclonal Marmoset WB, ELISA MO51276W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Marmoset, Rat (Rattus norvegicus)
CloneMO66492FYA
SpecificityThis antibody binds to Zebrafish arl10.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Zebrafish arl10 Antibody is a mouse antibody against arl10. It can be used for arl10 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative Namesarl10
UniProt IDE7F7T7
Protein RefseqThe length of the protein is 218 amino acids long.
The sequence is show below: MVVLRHFSVAFSAAMAAVGTALFIALNLFYKRRVWTPESEYFTFREEEEERSEKQVLVLGLDGAGKSSVLQGLSGAGYRRGCRPTRGFNFISLNTPACQLDFLEIGGGEDLRMYWADYLRRTNILVYVVDSSDRSRLPQAKDELHRLLKAETDLPVVVLGNKQDKPDAVSVPELREALSLSSVADQRKLFLLAAQSGSDGLSRTCSLQKIQDLLLKLV.
For Research Use Only | Not For Clinical Use.
Online Inquiry