AibGenesis™ Mouse Anti-arl14 Antibody (CBMOAB-66500FYA)


Cat: CBMOAB-66500FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-66500FYA Monoclonal Zebrafish (Danio rerio), Rat (Rattus norvegicus) WB, ELISA MO66500FYA 100 µg
MO-AB-24152H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO24152C 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio), Rat (Rattus norvegicus)
CloneMO66500FYA
SpecificityThis antibody binds to Zebrafish arl14.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationPlasma Membrane; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Zebrafish arl14 Antibody is a mouse antibody against arl14. It can be used for arl14 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative Namesarl14; si:dkey-119f1.4; ADP Ribosylation Factor Like GTPase 14
UniProt IDB8JLB2
Protein RefseqThe length of the protein is 201 amino acids long.
The sequence is show below: MGHSGSRHKPEARILLLGLDNAGKSTLLYKLKYDENFHTVPTIGFNVEMIEAKKNRDKISLTVWDVGGQAKMRAFWRNFYQDTAGIVFVVDSSDVKRLDEAKGVLEQSLRSEHLRGLPVVVLANKQDIVGAATVTEITEQFNLRKSCSDRDWFIQPCSALTGAGLVDGFRRMAHLVKMTPDDNNIKETVKYIRAKSVIQKK.
For Research Use Only | Not For Clinical Use.
Online Inquiry