AibGenesis™ Mouse Anti-arl5c Antibody (CBMOAB-66528FYA)


Cat: CBMOAB-66528FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-66528FYA Monoclonal Zebrafish (Danio rerio), Frog (Xenopus laevis), Rat (Rattus norvegicus), Sheep (Ovis aries) WB, ELISA MO66528FYA 100 µg
MO-AB-01586H Monoclonal Frog (Xenopus laevis) WB, ELISA MO01586C 100 µg
MO-AB-14247Y Monoclonal Sheep (Ovis aries) WB, ELISA MO14247Y 100 µg
MO-AB-24166H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO24166C 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio), Frog (Xenopus laevis), Rat (Rattus norvegicus), Sheep (Ovis aries)
CloneMO66528FYA
SpecificityThis antibody binds to Zebrafish arl5c.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationGolgi apparatus; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Zebrafish arl5c Antibody is a mouse antibody against arl5c. It can be used for arl5c detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesADP-ribosylation factor-like 5C; arl5
UniProt IDQ6P6E8
Protein RefseqThe length of the protein is 179 amino acids long.
The sequence is show below: MGLLFAKLMTLFGDREHKVIIVGLDNAGKTTILYQFLTKEAVQTSPTIGSNVEEIAIKKTRFLVWDIGGQESLRATWNSYYTNTEIIILVVDSTDRERLTVTKEELHRMLAHEDLQNASVLVLANKQDMEDSMTAAEISQSLTLSSLTARSWHVQACCALTGEGLPASLDWMRSRVVAN.
For Research Use Only | Not For Clinical Use.
Online Inquiry