Connect with Us at the Upcoming Events

Creative Biolabs is excited to greet you at the upcoming international conferences. Meet our team at the 13th Annual World ADC San Diego and the 13th Annual World Multispecific Summit in September, the 10th Annual Immuno-Oncology Summit in October, and the Antibody Engineering & Therapeutics (US) 2022 in December for expert consultation on your drug discovery projects. Shoot an email to arrange an in-person meeting!

Mouse Anti-Zebrafish asip Antibody (CBMOAB-63803FYA)


Cat: CBMOAB-63803FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio)
CloneMO63803FYA
SpecificityThis antibody binds to Zebrafish asip.
FormatLyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationExtracellular region or secreted

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionIn mice, the agouti gene encodes a paracrine signaling molecule that causes hair follicle melanocytes to synthesize pheomelanin, a yellow pigment, instead of the black or brown pigment, eumelanin. Pleiotropic effects of constitutive expression of the mouse gene include adult-onset obesity, increased tumor susceptibility, and premature infertility. This gene is highly similar to the mouse gene and encodes a secreted protein that may (1) affect the quality of hair pigmentation, (2) act as a pharmacological antagonist of alpha-melanocyte-stimulating hormone, (3) play a role in neuroendocrine aspects of melanocortin action, and (4) have a functional role in regulating lipid metabolism in adipocytes.
Product OverviewMouse Anti-Zebrafish asip (clone MO63803FYA) Antibody (CBMOAB-63803FYA) is a mouse antibody against asip. It can be used for asip detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesLOC798574 protein; asip
UniProt IDB3DGI7
Protein RefseqThe length of the protein is 125 amino acids long.
The sequence is show below: MSPSLWLCCVLLCLVCCVTVHTHMPMEEQHSSNQSNSNLLANNQTDAPPVLIIGLSKTPKKSKKSEKKPKKKFPNKVKRPPPPPNCVPLWASCKSPNAVCCDQCAFCHCRLLKTVCYCRMGYPKC.
For Research Use Only | Not For Clinical Use.

Online Inquiry