Mouse Anti-Zebrafish atg9b Antibody (CBMOAB-66935FYA)


Cat: CBMOAB-66935FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio)
CloneMO66935FYA
SpecificityThis antibody binds to Zebrafish atg9b.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationGolgi apparatus; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene functions in the regulation of autophagy, a lysosomal degradation pathway. This gene also functions as an antisense transcript in the posttranscriptional regulation of the endothelial nitric oxide synthase 3 gene, which has 3' overlap with this gene on the opposite strand. Mutations in this gene and disruption of the autophagy process have been associated with multiple cancers. Alternative splicing results in multiple transcript variants.
Product OverviewMouse Anti-Zebrafish atg9b Antibody is a mouse antibody against atg9b. It can be used for atg9b detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative Namesatg9b; Autophagy Related 9B
UniProt IDE9QJ02
Protein RefseqThe length of the protein is 806 amino acids long.
The sequence is show below: MAGFETYQEYQRIHDYDEDSPPGEEDLLIHVPEGRGDPWHHIKNLDNFFTRIIYHFHQKNGFACMVLSEFFELVQFLFVVTFTTFLFNCVEYDVLFANRAVNHTGQSLGPLDRSKVTLPDAILPSEQCTERIQGNSWIIFLLIMAAIFWVYRLVKVICNVLSYWEIRQFYIKALKIQMDELCNFTWQEVQNRLILLQREHPMCVQKRELSELDIYHRILRFKNYTVAMINKSLLPVRLRVPFIGDVIFLTQGLKYNFELILFWGPLSLFQNKWSLHPKYKRAANRHDLAKQLSRVILLTGLVNLLLCPFVLVWQVLYAFFSYAEVIKREPGSLGAHRWSLFGRLYLRHFNELDHELQGRLGRGYKPAAKYMNAFVSPLLAVLAKNVAFFSGSVLAVLIALTVYDEDVLTVQHILTAITVLGVVITVTRSFIPDEHMVWCPEQLLQCVLAHIHYMPDHWQGSANKSETRDEMAQLFQYKAVFILEELLSPIITPFILIFPLRSKSLEIIDFFRNFTVDVAGVGDICSFAQMDIRRHGNPQWMSEGQTEASVYQQAENGKTELSLMHFTIKNPQWQPPQDSSIFISHLKEKVHQDAQTGPSTQLLLSEAPLCSSLLSNESGTGPDNLLASVLAHPVLTASGLPGRNRRFISPSSAASAAASVLASLSSSQQPHASRSRSHTLLPSRQQHDGHMYSSEHTVADSMSASDPRMLSQSRSALASEFASAEMSLHAIYMHEVHQQKTHHASGQFQAPVPMRDMSASAPQTVTLVPHTSGRLGGWAEEEEEEQGDEEEINSNPELQHTSRGSS.
For Research Use Only | Not For Clinical Use.
Online Inquiry