AibGenesis™ Mouse Anti-atp6v1f Antibody (CBMOAB-67157FYA)
Cat: CBMOAB-67157FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
| Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
| CBMOAB-67157FYA | Monoclonal | Zebrafish (Danio rerio), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Dog (Canis lupus familiaris), Elephant (Loxodonta africana), Ferret (Mustela Putorius Furo), Frog (Xenopus laevis), Marmoset, Medaka (Oryzias latipes), Nile tilapia (Oreochromis niloticus), O. anatinus (Ornithorhynchus anatinus), Pig (Sus scrofa), Rabbit (Oryctolagus cuniculus), Rat (Rattus norvegicus), Rhesus (Macaca mulatta), Sheep (Ovis aries) | WB, ELISA | MO67157FYA | 100 µg | ||
| MO-AB-00112R | Monoclonal | Medaka (Oryzias latipes) | WB, ELISA | MO00112R | 100 µg | ||
| MO-AB-00142L | Monoclonal | Elephant (Loxodonta africana) | WB, ELISA | MO00142L | 100 µg | ||
| MO-AB-01209W | Monoclonal | Rhesus (Macaca mulatta) | WB, ELISA | MO01209W | 100 µg | ||
| MO-AB-01749H | Monoclonal | Frog (Xenopus laevis) | WB, ELISA | MO01749C | 100 µg | ||
| MO-AB-06325Y | Monoclonal | O. anatinus (Ornithorhynchus anatinus) | WB, ELISA | MO06325Y | 100 µg | ||
| MO-AB-07315Y | Monoclonal | Rabbit (Oryctolagus cuniculus) | WB, ELISA | MO07315Y | 100 µg | ||
| MO-AB-07859R | Monoclonal | Cattle (Bos taurus) | WB, ELISA | MO07859R | 100 µg | ||
| MO-AB-12231W | Monoclonal | Chimpanzee (Pan troglodytes) | WB, ELISA | MO12231W | 100 µg | ||
| MO-AB-14318Y | Monoclonal | Sheep (Ovis aries) | WB, ELISA | MO14318Y | 100 µg | ||
| MO-AB-24004R | Monoclonal | Pig (Sus scrofa) | WB, ELISA | MO24004R | 100 µg | ||
| MO-AB-24258H | Monoclonal | Rat (Rattus norvegicus) | WB, ELISA | MO24258C | 100 µg | ||
| MO-AB-29172W | Monoclonal | Dog (Canis lupus familiaris) | WB, ELISA | MO29172W | 100 µg | ||
| MO-AB-32868H | Monoclonal | Nile tilapia (Oreochromis niloticus) | WB, ELISA | MO32868C | 100 µg | ||
| MO-AB-34444W | Monoclonal | Ferret (Mustela Putorius Furo) | WB, ELISA | MO34444W | 100 µg | ||
| MO-AB-51601W | Monoclonal | Marmoset | WB, ELISA | MO51601W | 100 µg |
Specifications
| Host species | Mouse (Mus musculus) |
| Species Reactivity | Zebrafish (Danio rerio), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Dog (Canis lupus familiaris), Elephant (Loxodonta africana), Ferret (Mustela Putorius Furo), Frog (Xenopus laevis), Marmoset, Medaka (Oryzias latipes), Nile tilapia (Oreochromis niloticus), O. anatinus (Ornithorhynchus anatinus), Pig (Sus scrofa), Rabbit (Oryctolagus cuniculus), Rat (Rattus norvegicus), Rhesus (Macaca mulatta), Sheep (Ovis aries) |
| Clone | MO67157FYA |
| Specificity | This antibody binds to Zebrafish atp6v1f. |
| Format | Liquid or Lyophilized |
| Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
| Purity | > 90% was determined by SDS-PAGE |
| Purification | Purified with Protein A or G affinity chromatography |
| Cellular Localization | Plasma Membrane; Other locations |
Application Information
| Application | WB, ELISA |
| Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
| Introduction | This gene encodes a component of vacuolar ATPase (V-ATPase), a multisubunit enzyme that mediates acidification of eukaryotic intracellular organelles. V-ATPase dependent organelle acidification is necessary for such intracellular processes as protein sorting, zymogen activation, receptor-mediated endocytosis, and synaptic vesicle proton gradient generation. V-ATPase is composed of a cytosolic V1 domain and a transmembrane V0 domain. The V1 domain consists of three A and three B subunits, two G subunits plus the C, D, E, F, and H subunits. The V1 domain contains the ATP catalytic site. The V0 domain consists of five different subunits: a, c, c', c", and d. Additional isoforms of many of the V1 and V0 subunit proteins are encoded by multiple genes or alternatively spliced transcript variants. This encoded protein is the V1 domain F subunit protein. (From NCBI) |
| Product Overview | Mouse Anti-Zebrafish atp6v1f Antibody is a mouse antibody against atp6v1f. It can be used for atp6v1f detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
| Alternative Names | V-type proton ATPase subunit F; atp6v1 |
| UniProt ID | Q6DRK0 |
| Protein Refseq | The length of the protein is 119 amino acids long. The sequence is show below: MPGRGKLIAVIGDEDTCTGFLLGGIGELNKNRKPNFLVVEKETSVTEIEETFKSFLARNDIGIILINQFIAEMIRHAIDAHMQSIPAVLEIPSKEHPYDASKDSILRRAKGMFSAEDFR. |
For Research Use Only | Not For Clinical Use.
Online Inquiry