AibGenesis™ Mouse Anti-atpaf1 Antibody (CBMOAB-67191FYA)


Cat: CBMOAB-67191FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-67191FYA Monoclonal Zebrafish (Danio rerio), Chimpanzee (Pan troglodytes), Rhesus (Macaca mulatta) WB, ELISA MO67191FYA 100 µg
MO-AB-01214W Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO01214W 100 µg
MO-AB-16678W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO16678W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio), Chimpanzee (Pan troglodytes), Rhesus (Macaca mulatta)
CloneMO67191FYA
SpecificityThis antibody binds to Zebrafish atpaf1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationMitochondrion

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes an assembly factor for the F(1) component of the mitochondrial ATP synthase. This protein binds specifically to the F1 beta subunit and is thought to prevent this subunit from forming nonproductive homooligomers during enzyme assembly. Alternatively spliced transcript variants have been identified. (From NCBI)
Product OverviewMouse Anti-Zebrafish atpaf1 Antibody is a mouse antibody against atpaf1. It can be used for atpaf1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesATP synthase mitochondrial F1 complex assembly factor 1; atpaf
UniProt IDF1Q4Z5
Protein RefseqThe length of the protein is 304 amino acids long.
The sequence is show below: XQMWDGEKMAAAMVQMSCLYRGMLAVRNHGIRPLIPGLVPSHFRAFSMKKEPELEENPYYSKYEEKIRKLRSSKPQEYESRLEKRTELKTEPLGRSRQAEFVKYMEKELDKRGKDGDGGFTKDKTLGSILNLEMVQEKSGAEITELWMQYFSKKDTISAVIPSSTFDVIFGRAKSCPTFLYALPQNEGYEFFVGQWAGNELHFTSLINVQTMGENAPSQLILYHYTDLQKDKDIVLMTAEMDSKFVTVHQAQCLANQVQLFYGSQRLETFRLVETFNHKPEEFKHMAVIAELEQSGIGPAVTTK.
For Research Use Only | Not For Clinical Use.
Online Inquiry