AibGenesis™ Mouse Anti-b9d2 Antibody (CBMOAB-67355FYA)


Cat: CBMOAB-67355FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-67355FYA Monoclonal Zebrafish (Danio rerio), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Marmoset, Rat (Rattus norvegicus) WB, ELISA MO67355FYA 100 µg
MO-AB-07943R Monoclonal Cattle (Bos taurus) WB, ELISA MO07943R 100 µg
MO-AB-11894W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO11894W 100 µg
MO-AB-24311H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO24311C 100 µg
MO-AB-51701W Monoclonal Marmoset WB, ELISA MO51701W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Marmoset, Rat (Rattus norvegicus)
CloneMO67355FYA
SpecificityThis antibody binds to Zebrafish b9d2.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationCytoskeleton; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a B9 domain protein, which are exclusively found in ciliated organisms. The gene is upregulated during mucociliary differentiation, and the encoded protein localizes to basal bodies and cilia. Disrupting expression of this gene results in ciliogenesis defects. (From NCBI)
Product OverviewMouse Anti-Zebrafish b9d2 Antibody is a mouse antibody against b9d2. It can be used for b9d2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesB9 domain-containing protein 2; b9d2; NP_001002394.
UniProt IDQ6DGZ1
Protein RefseqThe length of the protein is 175 amino acids long.
The sequence is show below: MAELHIIGQIIGATGFPQNSLFCKWGVHTGGAWRLLSGLREGQTQVDMPQTGDMAYWSHPIDLHYTTKGLQGWPKLHLQVWHQDSFGRCQLYGYGYIHVPSSPGQHRLQCVTWRPLGSWQDQLSEMFVGGGPQLRSPDLIYSGADRYRLHTVGMGTVELELCIILRHFDRYGVES.
For Research Use Only | Not For Clinical Use.
Online Inquiry