Mouse Anti-Zebrafish bag4 Antibody (CBMOAB-67382FYA)


Cat: CBMOAB-67382FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio)
CloneMO67382FYA
SpecificityThis antibody binds to Zebrafish bag4.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThe protein encoded by this gene is a member of the BAG1-related protein family. BAG1 is an anti-apoptotic protein that functions through interactions with a variety of cell apoptosis and growth related proteins including BCL-2, Raf-protein kinase, steroid hormone receptors, growth factor receptors and members of the heat shock protein 70 kDa family. This protein contains a BAG domain near the C-terminus, which could bind and inhibit the chaperone activity of Hsc70/Hsp70. This protein was found to be associated with the death domain of tumor necrosis factor receptor type 1 (TNF-R1) and death receptor-3 (DR3), and thereby negatively regulates downstream cell death signaling. The regulatory role of this protein in cell death was demonstrated in epithelial cells which undergo apoptosis while integrin mediated matrix contacts are lost. Alternatively spliced transcript variants encoding distinct isoforms have been identified.
Product OverviewMouse Anti-Zebrafish bag4 Antibody is a mouse antibody against bag4. It can be used for bag4 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative Namesbag4; BCL2 Associated Athanogene 4
UniProt IDB8JJ17
Protein RefseqThe length of the protein is 399 amino acids long.
The sequence is show below: MAFDSAGSDRGRGEASWIMHQQMQPETKSPWPSSYKSENNNVNWNNGMESQYPGYSSYWYPQSHTAGPYGSSYPPGTEVNGQASYNPQAMPAYPNGVYNPGQYSTSMLHPSNPFYCSDQVPSRQPHYHNQSCPEQNAGGSTHPPYPVPHCQAAPGYPAGSYPHYPEGCPQNAPYPNQQPVLSRPQHEAWSHTQGYGPTLPQQQWPSDSQTPHSHYGSHVRPPHPPPWQGPAPPPYEHKDPPYQSQPHMQPKNQPAGSRPRVSTPNSSALPPKPTQFSSPPQIYKTSSGVGGLEPKPAQNEQPPMSSPPASSMPAPLKDNSSLARVQQILARVQLLQEDVDEFVGKKTDKSYRCLEELLTKELLELDSVETYGQDVVRQARKEAVRRIQAILECLEKKAF.
For Research Use Only | Not For Clinical Use.
Online Inquiry