AibGenesis™ Mouse Anti-bmp8a Antibody (CBMOAB-67791FYA)


Cat: CBMOAB-67791FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-67791FYA Monoclonal Zebrafish (Danio rerio), Marmoset WB, ELISA MO67791FYA 100 µg
MO-AB-51904W Monoclonal Marmoset WB, ELISA MO51904W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio), Marmoset
CloneMO67791FYA
SpecificityThis antibody binds to Zebrafish bmp8a.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationOther locations; Extracellular region or secreted

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a secreted ligand of the TGF-beta (transforming growth factor-beta) superfamily of proteins. Ligands of this family bind various TGF-beta receptors leading to recruitment and activation of SMAD family transcription factors that regulate gene expression. The encoded preproprotein is proteolytically processed to generate each subunit of the disulfide-linked homodimer. This protein may play a role in development of the reproductive system. This gene may have arose from a gene duplication event and its gene duplicate is also present on chromosome 1. (From NCBI)
Product OverviewMouse Anti-Zebrafish bmp8a Antibody is a mouse antibody against bmp8a. It can be used for bmp8a detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative Namesbmp8a; Bone Morphogenetic Protein 8a
UniProt IDQ1LWW7
Protein RefseqThe length of the protein is 433 amino acids long.
The sequence is show below: MDRHEVEIVSSKHQSRGRKRTRLFPPSIFLPLCVLLCVWGQVEGVVHSSFRRLSGREKKEMQKEILSILGLPGRPRPHPPLRPPSSAPLFMLDLYHAVSSEADDRPGLGFTPEVVSHAALPTLSTHMPPLGTVVSEADTVMSFVNLVEQEKDLLQPRPYWKEFRFDLTPLPQGETVTAAEFRIYKTLTMGWRFNHTLHISVYEILREKRHREPELVLLDMQSVPAGQEGWLAFDVTSASNRWLLHPRSNLGIRLYVETEEDHRSWVGLVGRRGPRSKQPFMVTFFRASQAPCRPPRALKHTNQRKKKTKYDLPHPNRPGIFDQNHSSGRQACKKHELYVSFSDLGWKDWVLAPTGYSAYYCDGECDYPLGSCMNATNHAMIQLLVHLLRPDEVPKACCAPTKLSPIAVLFYDDNNNVILKKQRNMVVKNCGCL.
For Research Use Only | Not For Clinical Use.
Online Inquiry