Mouse Anti-Zebrafish bpgm Antibody (CBMOAB-67869FYA)


Cat: CBMOAB-67869FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio)
CloneMO67869FYA
SpecificityThis antibody binds to Zebrafish bpgm.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Introduction2,3-diphosphoglycerate (2,3-DPG) is a small molecule found at high concentrations in red blood cells where it binds to and decreases the oxygen affinity of hemoglobin. This gene encodes a multifunctional enzyme that catalyzes 2,3-DPG synthesis via its synthetase activity, and 2,3-DPG degradation via its phosphatase activity. The enzyme also has phosphoglycerate phosphomutase activity. Deficiency of this enzyme increases the affinity of cells for oxygen. Mutations in this gene result in hemolytic anemia. Multiple alternatively spliced variants, encoding the same protein, have been identified.
Product OverviewMouse Anti-Zebrafish bpgm Antibody is a mouse antibody against bpgm. It can be used for bpgm detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesZgc:92230; bpgm; zgc:9223
UniProt IDQ6DHM0
Protein RefseqThe length of the protein is 259 amino acids long.
The sequence is show below: MSKYKLFLLRHGEGAWNKENRFCSWVDQKLSENGVVEAQECGRLLKENGYQLDQVFTSILSRSIHTAWLVLEAMGHEWVPVTKSWRLNERHYGALIGLNRAEMALNHGEEQVKLWRRSYDITPPPIHESHPYYAEIYNDRRYSTCDVPKEELPKTESLKEVLDRLLPYWNDVIVPVIKSGQTVLISAHGNSCRALLKHLEAISETDIVNVTLPTGVPVLLELDEDLRPVKPRQLLGDQAKIQAAIKKVEDQGKVNAQNK.
For Research Use Only | Not For Clinical Use.
Online Inquiry