AibGenesis™ Mouse Anti-btg3 Antibody (CBMOAB-68052FYA)


Cat: CBMOAB-68052FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-68052FYA Monoclonal Zebrafish (Danio rerio), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Goat (Capra hircus), Marmoset, O. mykiss (Oncorhynchus mykiss), Pig (Sus scrofa), Rat (Rattus norvegicus), Sheep (Ovis aries) WB, ELISA MO68052FYA 100 µg
MO-AB-09179R Monoclonal Cattle (Bos taurus) WB, ELISA MO09179R 100 µg
MO-AB-10764Y Monoclonal O. mykiss (Oncorhynchus mykiss) WB, ELISA MO10764Y 100 µg
MO-AB-14408Y Monoclonal Sheep (Ovis aries) WB, ELISA MO14408Y 100 µg
MO-AB-19310W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO19310W 100 µg
MO-AB-24199R Monoclonal Pig (Sus scrofa) WB, ELISA MO24199R 100 µg
MO-AB-24438H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO24438C 100 µg
MO-AB-36813W Monoclonal Goat (Capra hircus) WB, ELISA MO36813W 100 µg
MO-AB-51996W Monoclonal Marmoset WB, ELISA MO51996W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Goat (Capra hircus), Marmoset, O. mykiss (Oncorhynchus mykiss), Pig (Sus scrofa), Rat (Rattus norvegicus), Sheep (Ovis aries)
CloneMO68052FYA
SpecificityThis antibody binds to Zebrafish btg3.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationNucleus; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThe protein encoded by this gene is a member of the BTG/Tob family. This family has structurally related proteins that appear to have antiproliferative properties. This encoded protein might play a role in neurogenesis in the central nervous system. Two transcript variants encoding different isoforms have been found for this gene. (From NCBI)
Product OverviewMouse Anti-Zebrafish btg3 Antibody is a mouse antibody against btg3. It can be used for btg3 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative Namesbtg3; Proliferation Factor 3
UniProt IDF1Q5N6
Protein RefseqThe length of the protein is 160 amino acids long.
The sequence is show below: MKKEIAAVVFFLKRLIKKAEKLDADKVDLFVERLTVALQEKYKGHWYPDNPSKGQAFRCIRVNRFQKEDAELLRACAESGVQYKDLGLPKELTLWVDPGEVCCRYGEKNHGFTVATFSSEDDDDKEDVTKKVTSAVERVTSDYHSGSSSDEDISMLVHRC.
For Research Use Only | Not For Clinical Use.
Online Inquiry