Mouse Anti-Zebrafish c5ar1 Antibody (CBMOAB-68332FYA)


Cat: CBMOAB-68332FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio)
CloneMO68332FYA
SpecificityThis antibody binds to Zebrafish c5ar1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationPlasma Membrane; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionC5AR1 (Complement C5a Receptor 1) is a Protein Coding gene. Diseases associated with C5AR1 include Mannose-Binding Lectin Deficiency and Systemic Lupus Erythematosus. Among its related pathways are Creation of C4 and C2 activators and Complement and coagulation cascades. Gene Ontology (GO) annotations related to this gene include G-protein coupled receptor activity and complement component C5a binding. An important paralog of this gene is C5AR2.
Product OverviewMouse Anti-Zebrafish c5ar1 Antibody is a mouse antibody against c5ar1. It can be used for c5ar1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesC5a anaphylatoxin chemotactic receptor 1; C5a anaphylatoxin chemotactic receptor; C5a-R; C5aR; c5ar
UniProt IDP0C7U5
Protein RefseqThe length of the protein is 346 amino acids long.
The sequence is show below: MDDNNSDWTSYDFGNDTIPSPNEISLSHIGTRHWITLVCYGIVFLLGVPGNALVVWVTGFRMPNSVNAQWFLNLAIADLLCCLSLPILMVPLAQDQHWPFGALACKLFSGIFYMMMYCSVLLLVVISLDRFLLVTKPVWCQNNRQPRQARILCFIIWILGLLGSSPYFAHMEIQHHSETKTVCTGSYSSLGHAWAITIIRSFLFFLLPFLIICISHWKVYHMTSSGRRQRDKSSRTLRVILALVLGFFLCWTPLHIVDLLILVSDQPSERFEVNLNLAHVLTLCLAYINSCLNPLLYVCLGRGFKENLISSLRSVLHFASEAPTHGPSMTTNSKSTTDGVFREKPV.
For Research Use Only | Not For Clinical Use.
Online Inquiry