Mouse Anti-Zebrafish cbln1 Antibody (CBMOAB-69176FYA)


Cat: CBMOAB-69176FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio)
CloneMO69176FYA
SpecificityThis antibody binds to Zebrafish cbln1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a cerebellum-specific precursor protein, precerebellin, with similarity to the globular (non-collagen-like) domain of complement component C1qB. Precerebellin is processed to give rise to several derivatives, including the hexadecapeptide, cerebellin, which is highly enriched in postsynaptic structures of Purkinje cells. Cerebellin has also been found in human and rat adrenals, where it has been shown to enhance the secretory activity of this gland.
Product OverviewMouse Anti-Zebrafish cbln1 Antibody is a mouse antibody against cbln1. It can be used for cbln1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative Namescbln1; Cerebellin 1 Precursor
UniProt IDQ1L944
Protein RefseqThe length of the protein is 190 amino acids long.
The sequence is show below: MMLTLVLGAVWLVCHAYAQNETEPIVLEGKCLVVCDSNPTSDPTGTALGISVRSGSAKVAFSVVRNTNHEPSEMSNRTMVIYFDQVLVNVGRSFDEERSNFFAPRKGIYSFNFHVVKVYNRQTIQVSLMHNGWPVISAFAGDQDVTREAASNGVLIQMEKGDRAYLKLERGNLMGGWKYSTFSGFLVFPL.
For Research Use Only | Not For Clinical Use.
Online Inquiry