AibGenesis™ Mouse Anti-ccdc167 Antibody (CBMOAB-69341FYA)


Cat: CBMOAB-69341FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-69341FYA Monoclonal Zebrafish (Danio rerio), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Marmoset, Rat (Rattus norvegicus) WB, ELISA MO69341FYA 100 µg
MO-AB-09624R Monoclonal Cattle (Bos taurus) WB, ELISA MO09624R 100 µg
MO-AB-24551H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO24551C 100 µg
MO-AB-25409W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO25409W 100 µg
MO-AB-52389W Monoclonal Marmoset WB, ELISA MO52389W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Marmoset, Rat (Rattus norvegicus)
CloneMO69341FYA
SpecificityThis antibody binds to Zebrafish ccdc167.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Zebrafish ccdc167 Antibody is a mouse antibody against ccdc167. It can be used for ccdc167 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesCoiled-coil domain-containing protein 167; ccdc167; NP_001020655.
UniProt IDQ5RHZ2
Protein RefseqThe length of the protein is 100 amino acids long.
The sequence is show below: MTRTRTVKKEKISVASEIDRVEERKLQCKNSLERAEFRKRKQQLSDDDRLALEDEMTILNERVEKYEKDLQVLRGENRRNMMLSVALLAISALFYYTFIY.
For Research Use Only | Not For Clinical Use.
Online Inquiry