AibGenesis™ Mouse Anti-ccdc28b Antibody (CBMOAB-69379FYA)


Cat: CBMOAB-69379FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-69379FYA Monoclonal Zebrafish (Danio rerio), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Marmoset, Rat (Rattus norvegicus) WB, ELISA MO69379FYA 100 µg
MO-AB-09633R Monoclonal Cattle (Bos taurus) WB, ELISA MO09633R 100 µg
MO-AB-14694W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO14694W 100 µg
MO-AB-24560H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO24560C 100 µg
MO-AB-52398W Monoclonal Marmoset WB, ELISA MO52398W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Marmoset, Rat (Rattus norvegicus)
CloneMO69379FYA
SpecificityThis antibody binds to Zebrafish ccdc28b.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Zebrafish ccdc28b Antibody is a mouse antibody against ccdc28b. It can be used for ccdc28b detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative Namesccdc28b; si:dkey-71p21.10; Coiled-Coil Domain Containing 28B
UniProt IDB8A4M8
Protein RefseqThe length of the protein is 213 amino acids long.
The sequence is show below: MEDKRKKRSPKVSLPQPPPPPINPRKLTVLPASKSATFSLGLPQPPSPKPRGKYKRSVGAMGPSKEALAVPVVPPKNTRPHREKPRAPQPAGPSRVSQSSSPLQHTFLTDVSDVREMEGGLLNLLNDFHSGKLQAFGKVCSFEQLEHVREMQERLARLHFSLDSHVEELSEDQRKNASDRNLEHLLSNLEELSTSIQKLHLAENQDLPKTSNT.
For Research Use Only | Not For Clinical Use.
Online Inquiry