AibGenesis™ Mouse Anti-cdkn2aipnl Antibody (CBMOAB-69949FYA)


Cat: CBMOAB-69949FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-69949FYA Monoclonal Zebrafish (Danio rerio), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Marmoset, Rat (Rattus norvegicus) WB, ELISA MO69949FYA 100 µg
MO-AB-02288H Monoclonal Frog (Xenopus laevis) WB, ELISA MO02288C 100 µg
MO-AB-09995R Monoclonal Cattle (Bos taurus) WB, ELISA MO09995R 100 µg
MO-AB-24699H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO24699C 100 µg
MO-AB-26021W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO26021W 100 µg
MO-AB-52741W Monoclonal Marmoset WB, ELISA MO52741W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Marmoset, Rat (Rattus norvegicus)
CloneMO69949FYA
SpecificityThis antibody binds to Zebrafish cdkn2aipnl.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationNucleus

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Zebrafish cdkn2aipnl Antibody is a mouse antibody against cdkn2aipnl. It can be used for cdkn2aipnl detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative Namescdkn2aipnl; CDKN2A Interacting Protein N-Terminal Like
UniProt IDI3ITJ4
Protein RefseqThe length of the protein is 111 amino acids long.
The sequence is show below: MASMDVEEFIGQNRQLADRVEAFRGFSESDKHWKGRREFIFRNMADFPEPQVDHLLALSMVWQNHVFMGCRYSSELLQRVMEMAEGIEVEDAPVFKTRDEIIRQQKVRIYT.
For Research Use Only | Not For Clinical Use.
Online Inquiry