AibGenesis™ Mouse Anti-cep19 Antibody (CBMOAB-70094FYA)


Cat: CBMOAB-70094FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-70094FYA Monoclonal Zebrafish (Danio rerio), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Rat (Rattus norvegicus) WB, ELISA MO70094FYA 100 µg
MO-AB-10073R Monoclonal Cattle (Bos taurus) WB, ELISA MO10073R 100 µg
MO-AB-24726H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO24726C 100 µg
MO-AB-26785W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO26785W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Rat (Rattus norvegicus)
CloneMO70094FYA
SpecificityThis antibody binds to Zebrafish cep19.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationCytoskeleton; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThe protein encoded by this gene localizes to centrosomes and primary cilia and co-localizes with a marker for the mother centriole. This gene resides in a region of human chromosome 3 that is linked to morbid obesity. A homozygous knockout of the orthologous gene in mouse resulted in mice with morbid obesity, hyperphagy, glucose intolerance, and insulin resistance. Mutations in this gene cause morbid obesity and spermatogenic failure (MOSPGF). This gene has a pseudogene on human chromosome 2. (From NCBI)
Product OverviewMouse Anti-Zebrafish cep19 Antibody is a mouse antibody against cep19. It can be used for cep19 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesCentrosomal protein of 19 kDa; Cep19; cep1
UniProt IDQ4V8Z3
Protein RefseqThe length of the protein is 161 amino acids long.
The sequence is show below: MSIVAKRCGVKFTPPSIIIIYENKTSGKMRKRVIPVRNFSQYSDCSRAAERLKHHVRHSVYLECVSLAQLERLHLLLRDHLQGASLEESLAAHRHQEEEEDLNKLSDEELSRRKAQMDDLFQRNRRRRGDPDFVYDLEVEFGEGSVKETCSWDEEQSDQEF.
For Research Use Only | Not For Clinical Use.
Online Inquiry