Mouse Anti-chchd7 Antibody (CBMOAB-70307FYA)
Cat: CBMOAB-70307FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
CBMOAB-70307FYA | Monoclonal | Zebrafish (Danio rerio), Cattle (Bos taurus), Horse (Equus caballus), Rat (Rattus norvegicus) | WB, ELISA | MO70307FYA | 100 µg | ||
MO-AB-10144R | Monoclonal | Cattle (Bos taurus) | WB, ELISA | MO10144R | 100 µg | ||
MO-AB-24761H | Monoclonal | Rat (Rattus norvegicus) | WB, ELISA | MO24761C | 100 µg | ||
MO-AB-44035W | Monoclonal | Horse (Equus caballus) | WB, ELISA | MO44035W | 100 µg |
Specifications
Host species | Mouse (Mus musculus) |
Species Reactivity | Zebrafish (Danio rerio), Cattle (Bos taurus), Horse (Equus caballus), Rat (Rattus norvegicus) |
Clone | MO70307FYA |
Specificity | This antibody binds to Zebrafish chchd7. |
Format | Liquid or Lyophilized |
Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
Purity | > 90% was determined by SDS-PAGE |
Purification | Purified with Protein A or G affinity chromatography |
Application Information
Application | WB, ELISA |
Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
Product Overview | Mouse Anti-Zebrafish chchd7 Antibody is a mouse antibody against chchd7. It can be used for chchd7 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
Alternative Names | chchd7; Coiled-Coil-Helix-Coiled-Coil-Helix Domain Containing 7 |
UniProt ID | F1QKA5 |
Protein Refseq | The length of the protein is 88 amino acids long. The sequence is show below: MMANKSSAQKVRNADSNPCIEESDNSQRCLDAYNYDKNMCSAYFMKYKSCRKYWHDVMLQRKRSGVKPEMPNAEERQQILTALGGKPY. |
For Research Use Only | Not For Clinical Use.
Online Inquiry