Mouse Anti-Zebrafish chico Antibody (CBMOAB-63892FYA)


Cat: CBMOAB-63892FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio)
CloneMO63892FYA
SpecificityThis antibody binds to Zebrafish chico.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationNucleus; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionActivates phosphatidylinositol 3-kinase when bound to the regulatory p85 subunit (By similarity). May mediate the control of various cellular processes by insulin-like peptides. When phosphorylated by the insulin receptor binds specifically to various cellular proteins containing SH2 domains. Involved in control of cell proliferation, cell size, and body and organ growth throughout development. Also has a role in a signaling pathway controlling the physiological response required to endure periods of low nutrient conditions. Insulin/insulin-like growth factor (IGF) signaling pathway has a role in regulating aging and is necessary in the ovary for vitellogenic maturation.
Product OverviewMouse Anti-Zebrafish chico Antibody is a mouse antibody against chico. It can be used for chico detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesChico protein; chico
UniProt IDQ9PTS6
Protein RefseqThe length of the protein is 199 amino acids long.
The sequence is show below: MMFPQARHSASSQSTQPLKFTTSDSCDRIKDEFQFLQAQYHSLKLECDKLASEKSEMQRHYIMYYEMSYGLNIEMHKQAEIVKRLNGICAQVLPYLSQEHQQQVLGAIERAKQVTPPEMNSIIRQQLQVHQLSQLQGLALPMTPLPLGLTPPTLPAVTSSSGLLSLSSILASHAHLAKEDKSSRDAADGHRDEDADKSD.
See other products for " Chico "
For Research Use Only | Not For Clinical Use.
Online Inquiry