Mouse Anti-Zebrafish chm Antibody (CBMOAB-70393FYA)


Cat: CBMOAB-70393FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio)
CloneMO70393FYA
SpecificityThis antibody binds to Zebrafish chm.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationNucleus; Other locations; Cytosol

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes component A of the RAB geranylgeranyl transferase holoenzyme. In the dimeric holoenzyme, this subunit binds unprenylated Rab GTPases and then presents them to the catalytic Rab GGTase subunit for the geranylgeranyl transfer reaction. Rab GTPases need to be geranylgeranyled on either one or two cysteine residues in their C-terminus to localize to the correct intracellular membrane. Mutations in this gene are a cause of choroideremia; also known as tapetochoroidal dystrophy (TCD). This X-linked disease is characterized by progressive dystrophy of the choroid, retinal pigment epithelium and retina. Alternatively spliced transcript variants have been found for this gene.
Product OverviewMouse Anti-Zebrafish chm Antibody is a mouse antibody against chm. It can be used for chm detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesRab escort protein 1; ch
UniProt IDQ6RFG0
Protein RefseqThe length of the protein is 666 amino acids long.
The sequence is show below: MAAEDLPSQFDVVILGTGLTESVIAAACSRVGQSVLHLDRRNYYAGNWASFTFNGLLSWIEEYKNQQELQITESEQEWRSLIEDGEEAVPLNSVDSSISNLEVFCYASEEEEQEEETKDLLTCPNAETVSEETNSDSTETQDTVTSDDVTESNVKVQNEENEDSAPKEQLHASDISEHSQSVEEKQPNRSPADPPAELQKKITYQKLLKEGRRFNIDLVSKLMYSRGALVDLLIKSNVSRYAEFKNIGRILTCRNGKVEQVPCSRADVFASKQLTVVEKRMLMKFLTFCLDFEQHPEEYQDYSEKPFSEFLKNKKLTENLQDFVLLSIAMVTQQTLTEEGLKATQHFLRCLGRYGNTPFLFPLYGLGEIPQCFCRMCAVFGGIYCLRHSVQCLVVDKESNKVKAVIDTRGQKIGCSHFVVEDSYIREEQRESIDYRQISRAVLITDRSVLPSESDQQISLVTVPPVESSGPAVRMVELCSSSMTCMPGTCLVHLTCSSSGTAQQDLAPVVSQLFHIPTTPGEDPSEGTGEISKPAVLWVMYFNMRDTSAMDSSCYSLPSNVHVCTGPDAGLGSDYSIKLAESVFHCLLPDEEFCPPAPNPEDIIYDGDAPQAEGRGFDESNDTEANKSQAEEEGTTNETNPENSEAAEMDSVAQETTLDTNPPSEE.
For Research Use Only | Not For Clinical Use.
Online Inquiry