Mouse Anti-Zebrafish crk Antibody (CBMOAB-71735FYA)


Cat: CBMOAB-71735FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio)
CloneMO71735FYA
SpecificityThis antibody binds to Zebrafish crk.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionCRK (CRK Proto-Oncogene, Adaptor Protein) is a Protein Coding gene. Diseases associated with CRK include Sarcoma and Chromosome 17P13.3, Centromeric, Duplication Syndrome. Among its related pathways are RET signaling and NFAT and Cardiac Hypertrophy. Gene Ontology (GO) annotations related to this gene include protein domain specific binding and SH3/SH2 adaptor activity. An important paralog of this gene is CRKL.
Product OverviewMouse Anti-Zebrafish crk Antibody is a mouse antibody against crk. It can be used for crk detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesV-crk sarcoma virus CT10 oncogene homolog (Avian); cr
UniProt IDQ6DEM2
Protein RefseqThe length of the protein is 311 amino acids long.
The sequence is show below: MAGNFDSEDRGSWYWGRLSRQEAVSLLQGQRHGVFLVRDSITIPGDYVLSVSENSKVSHYIINSISSNRQSGPGLAPPRFRIGDQEFDALPALLEFYKIHYLDTTTLIEPISKSKHSSFISVNAGTGGAPPRLEEEYVRALFDFPGNDDEDLPFRKGDVLRVLEKPEEQWWNAQNSEGRVGMIPVPYVEKYRPASPTSGAPGVSVSGSGAHGNSDGHSTQSPPLLGEPGQYAQPTSLPNLQNGPVYARAIQKRVPNAYDKTALALEVGDMVKVTKINVNGQWEGECKGKHGHFPFTHVRLLDQHNPEDELS.
For Research Use Only | Not For Clinical Use.
Online Inquiry