AibGenesis™ Mouse Anti-Zebrafish ctdnep1b Antibody (CBMOAB-72112FYA)


Cat: CBMOAB-72112FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Specifications
  • Application Information
  • Target

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio)
CloneMO72112FYA
SpecificityThis antibody binds to Zebrafish ctdnep1b.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationNucleus; Endoplasmic reticulum; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionSerine/threonine protein phosphatase that may dephosphorylate and activate lipins. Lipins are phosphatidate phosphatases that catalyze the conversion of phosphatidic acid to diacylglycerol and control the metabolism of fatty acids at different levels. May indirectly modulate the lipid composition of nuclear and/or endoplasmic reticulum membranes and be required for proper nuclear membrane morphology and/or dynamics. May also indirectly regulate the production of lipid droplets and triacylglycerol. May antagonize BMP signaling. (From uniprot, under CC BY 4.0)
Product OverviewMouse Anti-Zebrafish ctdnep1b Antibody is a mouse antibody against ctdnep1b. It can be used for ctdnep1b detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesCTD nuclear envelope phosphatase 1B; EC 3.1.3.16; Dullard-like protein; Serine/threonine-protein phosphatase dullard-B; ctdnep1b; dullard
UniProt IDQ5U3T3
Protein RefseqThe length of the protein is 245 amino acids long.
The sequence is show below: MLKTRQCLLGVRTFHGVTSRIWSFFLYILRKHIRTIIQYQTVRYDILSLSPISRNRLNNVKRKILVLDLDETLIHSHHDGVLRPTVRPGTPPDFILKVVIDKHPVRFFVHKRPHVDFFLEVVSQWYELVVFTASMEIYGSAVADKLDNNKAILKRRYYRQHCTLDSGSYIKDLSVVHDDLSSVVILDNSPGAYRSHPDNAIPIKSWFSDPSDTALLNLLPMLDALRFPADVRSVLSRNLHQHRLW.
For Research Use Only | Not For Clinical Use.
Online Inquiry