Mouse Anti-Zebrafish dok2 Antibody (CBMOAB-63926FYA)


Cat: CBMOAB-63926FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio)
CloneMO63926FYA
SpecificityThis antibody binds to Zebrafish dok2.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThe protein encoded by this gene is constitutively tyrosine phosphorylated in hematopoietic progenitors isolated from chronic myelogenous leukemia (CML) patients in the chronic phase. It may be a critical substrate for p210(bcr/abl), a chimeric protein whose presence is associated with CML. This encoded protein binds p120 (RasGAP) from CML cells.
Product OverviewMouse Anti-Zebrafish dok2 Antibody is a mouse antibody against dok2. It can be used for dok2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesDocking Protein 2; dok2
UniProt IDF1QLU0
Protein RefseqThe length of the protein is 164 amino acids long.
The sequence is show below: XEDIRKKGMLYLQQQRFGKKWRKVWSVLYRESSCSISRLEFFEIKDGTPNTLEKANRKHENKKMNWPEKGTMRGNSLHSEPDDATMADNTLYCSRETTMKDFKVTVRRSEASERCSLKGVVLLRTDTDSLLLKDPKTGEVLYSWPYRFLRRFGRDKATFSFEAG.
See other products for " DOK2 "
CBMOAB-41103FYAMouse Anti-Rhesus DOK2 Antibody (CBMOAB-41103FYA)
MO-AB-11605RMouse Anti-Cattle DOK2 Antibody (MO-AB-11605R)
For Research Use Only | Not For Clinical Use.
Online Inquiry