Mouse Anti-Zebrafish eif3ea Antibody (CBMOAB-63936FYA)


Cat: CBMOAB-63936FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio)
CloneMO63936FYA
SpecificityThis antibody binds to Zebrafish eif3ea.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationNucleus; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionComponent of the eukaryotic translation initiation factor 3 (eIF-3) complex, which is involved in protein synthesis of a specialized repertoire of mRNAs and, together with other initiation factors, stimulates binding of mRNA and methionyl-tRNAi to the 40S ribosome. The eIF-3 complex specifically targets and initiates translation of a subset of mRNAs involved in cell proliferation.
Product OverviewMouse Anti-Zebrafish eif3ea Antibody is a mouse antibody against eif3ea. It can be used for eif3ea detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesEukaryotic translation initiation factor 3 subunit E-A; eif3ea
UniProt IDQ6DRI1
Protein RefseqThe length of the protein is 446 amino acids long.
The sequence is show below: MAEYDLTTKIAHFLDRHLVFPLLEFLSVKEIYNEHELLHGKLDLLSDTNMVDFAMDVYRNLFPDKEIPNSLREKRTTVVAQLKQLQSETEPIVKVFEDPETTRQMQSTRDGRMLFDYLADKHGFRQEYLDTLYRYAKFQYECGNYSGAAEYLYFFRVLVPATDRNALNSLWGKLASEILMQNWEAAMEDLTRLRETIDNNTVSSPLQSLQQRTWLIHWSLFVFFNHPKGRDNIIELFLYQPQYLNAIQTMCPHILRYLTTAVITNKDVRKRRQVLKDLVKVIQQESYTYKDPITEFVECLYVNFDFDSAQKKLRECEAVLVNDFFLVACLEDFIENARLFIFETFCRIHQCISIGMLADKLNMTPEEAERWIVNLIRNARLDAKIDSKLGHVVMGNNAISPYQQVIEKTKSLSFRSQMLAMNIEKKQSNANRNETPNWAAQDAGFY.
For Research Use Only | Not For Clinical Use.
Online Inquiry