AibGenesis™ Mouse Anti-epb41l4b Antibody (CBMOAB-75110FYA)


Cat: CBMOAB-75110FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-75110FYA Monoclonal Zebrafish (Danio rerio), Horse (Equus caballus) WB, ELISA MO75110FYA 100 µg
MO-AB-44601W Monoclonal Horse (Equus caballus) WB, ELISA MO44601W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio), Horse (Equus caballus)
CloneMO75110FYA
SpecificityThis antibody binds to Zebrafish epb41l4b.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationCytoskeleton

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Zebrafish epb41l4b Antibody is a mouse antibody against epb41l4b. It can be used for epb41l4b detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative Namesepb41l4b; Erythrocyte Membrane Protein Band 4.1 Like 4B
UniProt IDF8W419
Protein RefseqThe length of the protein is 431 amino acids long.
The sequence is show below: XMCAFQKHAKGQDLFDQIMYHLDLVEADYFGLQFMDPEQVAHWLDAAKPIKKQIRHGPPYRLFFRVKFYSSEPNNLHEEFTRYLFVLQLRQDILSGKLKCPYDVSVELGAYCLQSELGDCDPLEHSILLVSEFRFSPKQTEIMEADIYRKWVECRGMIPSQAELNFLNKCKWLEMYGVDMHFVKGRDGGEYALGLTPTGILVFEGSSKIGLFFWPKITRLDFKRNRLTLVVVEDDEKGREQEHTFVFQLSSSHECKHLWKCAVESHAFFRLRQPTHNKTSRSDFTRLGSRFRFSGRTEYQATHSGKVRRASTFERRPSKRYPSRAQSMVKAMTPAKHPHLSAQTSPEPSLKPYKHNIPIAQDPWQRSHPPPSLTSPLYIQPMELGHTPPPHRPSYVDRPPASSVGFGESDLVARNVRSVSVMHKDKLMTAL.
For Research Use Only | Not For Clinical Use.
Online Inquiry