Mouse Anti-Zebrafish etfb Antibody (CBMOAB-75411FYA)


Cat: CBMOAB-75411FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio)
CloneMO75411FYA
SpecificityThis antibody binds to Zebrafish etfb.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationMitochondrion

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes electron-transfer-flavoprotein, beta polypeptide, which shuttles electrons between primary flavoprotein dehydrogenases involved in mitochondrial fatty acid and amino acid catabolism and the membrane-bound electron transfer flavoprotein ubiquinone oxidoreductase. The gene deficiencies have been implicated in type II glutaricaciduria. Alternatively spliced transcript variants have been found for this gene.
Product OverviewMouse Anti-Zebrafish etfb Antibody is a mouse antibody against etfb. It can be used for etfb detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesElectron-transfer-flavoprotein, beta polypeptide; etf
UniProt IDQ7ZV76
Protein RefseqThe length of the protein is 254 amino acids long.
The sequence is show below: MSARVLVGVKRVIDYAVKIRVKPDHTGVVTDGVKHSMNPFCEIAVEEAVKLKEKKLIKEVVAVSCGPQQVQETIRTALAMGADRGIHVEVSGKDYETLGPLQVSKILAALAKKEEASLIILGKQAIDDDCNQTGQMTAALLDWPQGTFASELAFEADKLKVVREIDGGLETIKIKLPAVVTADLRLNTPRYATLPNIMKAKKKKIAMVKPADLGVDVSSRLEVLKVDEPPTRQAGVKVETVEDLVGKLKEAGRV.
See other products for " ETFB "
MO-AB-02560WMouse Anti-Fruit fly ETFB Antibody (MO-AB-02560W)
CBMOAB-42022FYAMouse Anti-Rhesus ETFB Antibody (CBMOAB-42022FYA)
MO-AB-25676HMouse Anti-Rat Etfb Antibody (MO-AB-25676H)
MO-AB-11727WMouse Anti-Chimpanzee ETFB Antibody (MO-AB-11727W)
MO-AB-07875WMouse Anti-Cat ETFB Antibody (MO-AB-07875W)
MO-AB-03384HMouse Anti-Frog etfb Antibody (MO-AB-03384H)
CBMOAB-28636FYCMouse Anti-Arabidopsis ETFB Antibody (CBMOAB-28636FYC)
CBMOAB-22636FYBMouse Anti-Rice ETFB Antibody (CBMOAB-22636FYB)
MO-AB-55127WMouse Anti-Marmoset ETFB Antibody (MO-AB-55127W)
MO-AB-12155RMouse Anti-Cattle ETFB Antibody (MO-AB-12155R)
For Research Use Only | Not For Clinical Use.
Online Inquiry