Mouse Anti-Zebrafish fabp2 Antibody (CBMOAB-75689FYA)


Cat: CBMOAB-75689FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio)
CloneMO75689FYA
SpecificityThis antibody binds to Zebrafish fabp2.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThe protein encoded by this gene is an intracellular fatty acid-binding protein that participates in the uptake, intracellular metabolism, and transport of long-chain fatty acids. The encoded protein is also involved in the modulation of cell growth and proliferation. This protein binds saturated long-chain fatty acids with high affinity, and may act as a lipid sensor to maintain energy homeostasis.
Product OverviewMouse Anti-Zebrafish fabp2 Antibody is a mouse antibody against fabp2. It can be used for fabp2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesFabp2 protein; Intestinal fatty acid binding protein; Intestinal fatty acid binding protein 2; fabp2; I-FABP (FABPI) IFAB
UniProt IDQ9PRH9
Protein RefseqThe length of the protein is 132 amino acids long.
The sequence is show below: MTFNGTWKVDRNENYEKFMEQMGVNMVKRKLAAHDNLKITLEQTGDKFNVKEVSTFRTLEINFTLGVTFDYSLADGTELTGSWVIEGDTLKGTFTRKDNGKVLTTVRTIVNGELVQSYSYDGVEAKRIFKRA.
For Research Use Only | Not For Clinical Use.
Online Inquiry