AibGenesis™ Mouse Anti-ferd3l Antibody (CBMOAB-76326FYA)


Cat: CBMOAB-76326FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-76326FYA Monoclonal Zebrafish (Danio rerio), Marmoset, Rat (Rattus norvegicus) WB, ELISA MO76326FYA 100 µg
MO-AB-25801H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO25801C 100 µg
MO-AB-55390W Monoclonal Marmoset WB, ELISA MO55390W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio), Marmoset, Rat (Rattus norvegicus)
CloneMO76326FYA
SpecificityThis antibody binds to Zebrafish ferd3l.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Zebrafish ferd3l Antibody is a mouse antibody against ferd3l. It can be used for ferd3l detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative Namesferd3l; Fer3 Like BHLH Transcription Factor
UniProt IDF1R7I0
Protein RefseqThe length of the protein is 81 amino acids long.
The sequence is show below: SPSTGSPEIAVNMKPKRKRVISTVQRQAANIRERKRMFSLNEAFDRLRRRVPTFAYEKRLSRIETLRLAIVYIAFMTDILE.
For Research Use Only | Not For Clinical Use.
Online Inquiry