AibGenesis™ Mouse Anti-fgf17 Antibody (CBMOAB-76400FYA)
Cat: CBMOAB-76400FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
| Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
| CBMOAB-76400FYA | Monoclonal | Zebrafish (Danio rerio), Cat (Felis catus), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Dog (Canis lupus familiaris), Elephant (Loxodonta africana), Ferret (Mustela Putorius Furo), Guinea pig (Cavia porcellus), Horse (Equus caballus), Mallard (Anas platyrhynchos), Marmoset, Nile tilapia (Oreochromis niloticus), O. anatinus (Ornithorhynchus anatinus), Pig (Sus scrofa), Rat (Rattus norvegicus), Sheep (Ovis aries) | WB, ELISA | MO76400FYA | 100 µg | ||
| MO-AB-00457L | Monoclonal | Elephant (Loxodonta africana) | WB, ELISA | MO00457L | 100 µg | ||
| MO-AB-06479Y | Monoclonal | O. anatinus (Ornithorhynchus anatinus) | WB, ELISA | MO06479Y | 100 µg | ||
| MO-AB-08421W | Monoclonal | Cat (Felis catus) | WB, ELISA | MO08421W | 100 µg | ||
| MO-AB-12522R | Monoclonal | Cattle (Bos taurus) | WB, ELISA | MO12522R | 100 µg | ||
| MO-AB-15254Y | Monoclonal | Sheep (Ovis aries) | WB, ELISA | MO15254Y | 100 µg | ||
| MO-AB-17397W | Monoclonal | Chimpanzee (Pan troglodytes) | WB, ELISA | MO17397W | 100 µg | ||
| MO-AB-23217H | Monoclonal | Mallard (Anas platyrhynchos) | WB, ELISA | MO23217C | 100 µg | ||
| MO-AB-25813H | Monoclonal | Rat (Rattus norvegicus) | WB, ELISA | MO25813C | 100 µg | ||
| MO-AB-25825R | Monoclonal | Pig (Sus scrofa) | WB, ELISA | MO25825R | 100 µg | ||
| MO-AB-30774W | Monoclonal | Dog (Canis lupus familiaris) | WB, ELISA | MO30774W | 100 µg | ||
| MO-AB-33092H | Monoclonal | Nile tilapia (Oreochromis niloticus) | WB, ELISA | MO33092C | 100 µg | ||
| MO-AB-34753W | Monoclonal | Ferret (Mustela Putorius Furo) | WB, ELISA | MO34753W | 100 µg | ||
| MO-AB-41647W | Monoclonal | Guinea pig (Cavia porcellus) | WB, ELISA | MO41647W | 100 µg | ||
| MO-AB-44741W | Monoclonal | Horse (Equus caballus) | WB, ELISA | MO44741W | 100 µg | ||
| MO-AB-55418W | Monoclonal | Marmoset | WB, ELISA | MO55418W | 100 µg |
Specifications
| Host species | Mouse (Mus musculus) |
| Species Reactivity | Zebrafish (Danio rerio), Cat (Felis catus), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Dog (Canis lupus familiaris), Elephant (Loxodonta africana), Ferret (Mustela Putorius Furo), Guinea pig (Cavia porcellus), Horse (Equus caballus), Mallard (Anas platyrhynchos), Marmoset, Nile tilapia (Oreochromis niloticus), O. anatinus (Ornithorhynchus anatinus), Pig (Sus scrofa), Rat (Rattus norvegicus), Sheep (Ovis aries) |
| Clone | MO76400FYA |
| Specificity | This antibody binds to Zebrafish fgf17. |
| Format | Liquid or Lyophilized |
| Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
| Purity | > 90% was determined by SDS-PAGE |
| Purification | Purified with Protein A or G affinity chromatography |
| Cellular Localization | Extracellular region or secreted |
Application Information
| Application | WB, ELISA |
| Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
| Introduction | This gene encodes a member of the fibroblast growth factor (FGF) family. Member of the FGF family possess broad mitogenic and cell survival activities, and are involved in a variety of biological processes including embryonic development cell growth, morphogenesis, tissue repair, tumor growth and invasion. This protein is expressed during embryogenesis and in the adult cerebellum and cortex and may be essential for vascular growth and normal brain development. Mutations in this gene are the cause of hypogonadotropic hypogonadism 20 with or without anosmia. Alternate splicing results in multiple transcript variants. (From NCBI) |
| Product Overview | Mouse Anti-Zebrafish fgf17 Antibody is a mouse antibody against fgf17. It can be used for fgf17 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
| Alternative Names | Fibroblast growth factor 17; FGF-17; Fibroblast growth factor 17b; FGF-17b; fgf17; fgf17b; NP_999973. |
| UniProt ID | Q6SJP8 |
| Protein Refseq | The length of the protein is 215 amino acids long. The sequence is show below: MYGINQRYLYISFHFFVVWCHAQGEKNHPSPNFKQYVREQGSLTDQLSRRQVRVYQLYSRTSGKHVQIRGHRVSATADDGNSYARLYVETDTFGSRVRIKGAESGRYLCMNRRGKLVGKPNGRGRDCIFTEIVLENNYTALENARHEGWFVAFTRKGRPIRASKTRQNQREVHFIKRLHKGPQPFPNAEQPKHFEFISFPSTRRAKRNRKHQTAS. |
For Research Use Only | Not For Clinical Use.
Online Inquiry