Mouse Anti-ftsj1 Antibody (CBMOAB-77235FYA)


Cat: CBMOAB-77235FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-77235FYA Monoclonal Zebrafish (Danio rerio), Cat (Felis catus), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Dog (Canis lupus familiaris), Elephant (Loxodonta africana), Ferret (Mustela Putorius Furo), Gorilla, Hamsters (Cricetinae), Horse (Equus caballus), Pig (Sus scrofa), Rabbit (Oryctolagus cuniculus), Sheep (Ovis aries) WB, ELISA MO77235FYA 100 µg
MO-AB-00490L Monoclonal Elephant (Loxodonta africana) WB, ELISA MO00490L 100 µg
MO-AB-08139Y Monoclonal Rabbit (Oryctolagus cuniculus) WB, ELISA MO08139Y 100 µg
MO-AB-08526W Monoclonal Cat (Felis catus) WB, ELISA MO08526W 100 µg
MO-AB-12739R Monoclonal Cattle (Bos taurus) WB, ELISA MO12739R 100 µg
MO-AB-15315Y Monoclonal Sheep (Ovis aries) WB, ELISA MO15315Y 100 µg
MO-AB-18289W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO18289W 100 µg
MO-AB-25944R Monoclonal Pig (Sus scrofa) WB, ELISA MO25944R 100 µg
MO-AB-30844W Monoclonal Dog (Canis lupus familiaris) WB, ELISA MO30844W 100 µg
MO-AB-34785W Monoclonal Ferret (Mustela Putorius Furo) WB, ELISA MO34785W 100 µg
MO-AB-38559W Monoclonal Gorilla WB, ELISA MO38559W 100 µg
MO-AB-43152W Monoclonal Hamsters (Cricetinae) WB, ELISA MO43152W 100 µg
MO-AB-44805W Monoclonal Horse (Equus caballus) WB, ELISA MO44805W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio), Cat (Felis catus), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Dog (Canis lupus familiaris), Elephant (Loxodonta africana), Ferret (Mustela Putorius Furo), Gorilla, Hamsters (Cricetinae), Horse (Equus caballus), Pig (Sus scrofa), Rabbit (Oryctolagus cuniculus), Sheep (Ovis aries)
CloneMO77235FYA
SpecificityThis antibody binds to Zebrafish ftsj1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a member of the methyltransferase superfamily. The encoded protein localizes to the nucleolus, binds to S-adenosylmethionine, and may be involved in the processing and modification of ribosomal RNA. Mutations in this gene are associated with cognitive disability. Alternative splicing results in multiple transcript variants. (From NCBI)
Product OverviewMouse Anti-Zebrafish ftsj1 Antibody is a mouse antibody against ftsj1. It can be used for ftsj1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesPutative tRNA (cytidine(32)/guanosine(34)-2'-O)-methyltransferase; EC 2.1.1.205; 2'-O-ribose RNA methyltransferase TRM7 homolog; ftsj
UniProt IDQ5U3P4
Protein RefseqThe length of the protein is 323 amino acids long.
The sequence is show below: MGRSSKDKRDIYYRLAKEEGWRARSAFKLLQLDEEFKLFRGVSRAVDLCAAPGSWSQVLSRKLRGKDKSEEVKIVAVDLQAMAPLPGVTQIQGDITKISTAEEIIRHFEGESADLVVCDGAPDVTGLHDVDEYIQAQLLLAALNITTHVLKPGGNFVAKIFRGKDVTLLYSQLKIFFSFVTCAKPPSSRNSSIEAFVVCQNYSPPEGYVPNMSNPLLDHSYDVDFNQLEGPNRIIVPFLACGDLSGFDSDRTYPLQLDSSKEYQYLPPTQPPIRPPYQQACQLRKSNLLAKEDSPSGALDEALTALDLNTKPDTSTTTPGASE.
For Research Use Only | Not For Clinical Use.
Online Inquiry