Mouse Anti-Zebrafish gdi2 Antibody (CBMOAB-77745FYA)


Cat: CBMOAB-77745FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio)
CloneMO77745FYA
SpecificityThis antibody binds to Zebrafish gdi2.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionGDP dissociation inhibitors are proteins that regulate the GDP-GTP exchange reaction of members of the rab family, small GTP-binding proteins of the ras superfamily, that are involved in vesicular trafficking of molecules between cellular organelles. GDIs slow the rate of dissociation of GDP from rab proteins and release GDP from membrane-bound rabs. GDI2 is ubiquitously expressed. The GDI2 gene contains many repetitive elements indicating that it may be prone to inversion/deletion rearrangements. Alternative splicing results in multiple transcript variants encoding distinct isoforms.
Product OverviewMouse Anti-Zebrafish gdi2 Antibody is a mouse antibody against gdi2. It can be used for gdi2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesGDP dissociation inhibitor 2; gdi
UniProt IDQ7ZVL9
Protein RefseqThe length of the protein is 448 amino acids long.
The sequence is show below: MNEEYDVIVLGTGLTECILSGIMSVKGKKVLHMDRNSYYGGESASITPLEDLFKRFSLPGSPPESMGKGRDWNVDLIPKSLMANGQLVRMLLITQVTRYLDFKVIEGSFVYKKGSIYKVPSTETEALASSLMGLFEKRRFRKFLVFVANFDENDPKTMEGVDPKKTTMRDVYKKFDLGQDVIDFTGHALALYRTDDYLDQPCIETINRIKLYSESLARYGKSPYLYPLYGLGELPQGFARLSAIYGGTYMLNKPIEEIVIENGKVVGVKSEGEIARCKQLTCDPSYIKDRVNKVGQVIRVICILSHPIKNTSDANSCQIIIPQNQVNRKHDIYVCMISYAHNVAAQGKYIAIVSTTVETNDPEKEIKPALDLLEPVEQKFVSISDLYSPTDVGSDSQIFISRSYDATTHFETTCDDIKDIYKRMTGTEFDFAEMERKKNDIFGDAADQ.
For Research Use Only | Not For Clinical Use.
Online Inquiry