Mouse Anti-Zebrafish gpt2 Antibody (CBMOAB-78567FYA)


Cat: CBMOAB-78567FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio)
CloneMO78567FYA
SpecificityThis antibody binds to Zebrafish gpt2.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a mitochondrial alanine transaminase, a pyridoxal enzyme that catalyzes the reversible transamination between alanine and 2-oxoglutarate to generate pyruvate and glutamate. Alanine transaminases play roles in gluconeogenesis and amino acid metabolism in many tissues including skeletal muscle, kidney, and liver. Activating transcription factor 4 upregulates this gene under metabolic stress conditions in hepatocyte cell lines. A loss of function mutation in this gene has been associated with developmental encephalopathy. Alternative splicing results in multiple transcript variants.
Product OverviewMouse Anti-Zebrafish gpt2 Antibody is a mouse antibody against gpt2. It can be used for gpt2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesAlanine aminotransferase 2-like; gpt
UniProt IDF1R6D2
Protein RefseqThe length of the protein is 545 amino acids long.
The sequence is show below: MFRLQSLAARSLVAGALDQCTPLISLTGVRHKSQAPTVEKYGQMRFSTAEAKVPAGGLHGKMREKTLTMDTLNPQVKAVEYAVRGPIVIKAGEIERCLEEGGTKPFSEVIKANIGDAHAMGQQPITFLRQVVALCTFPELMESPSFPEDAKWRARRILQGCGGHSLGSYSASAGVEYIRKDIAAYIEQRDEGVPSNWEDIYLTTGASDGIMTILRLLVSGKDSSRTGVMIPIPQYPLYSAAISEMDAVQVNYYLDEDNCWALDINELHRAYQAAKQHCQPRVICIINPGNPTGQVQSKKCIEEVLHFAYEENLFVMSDEVYQDNVYAPDCQFHSFKKVLYEMGPEYYNSVELASFHSTSKGYTGECGFRGGYMEVINMDPEVKAQLVKLLSVRLCPPLSGQAAMDVIVNPPQPDEHSYQQFHQEKSSVLGALAEKAKLTEEILNAVPGIKCNPVQGAMYAFPRIFIPPKAMEEAKTLGMQPDMLYCLRLLEETGICVVPGSGFGQKDGTYHFRMTILPSKEKLKVLLGKLRDFHVSFLKEYSALE.
For Research Use Only | Not For Clinical Use.
Online Inquiry