AibGenesis™ Mouse Anti-hmces Antibody (CBMOAB-79559FYA)


Cat: CBMOAB-79559FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-79559FYA Monoclonal Zebrafish (Danio rerio), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Marmoset WB, ELISA MO79559FYA 100 µg
MO-AB-13695R Monoclonal Cattle (Bos taurus) WB, ELISA MO13695R 100 µg
MO-AB-14503W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO14503W 100 µg
MO-AB-56817W Monoclonal Marmoset WB, ELISA MO56817W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Marmoset
CloneMO79559FYA
SpecificityThis antibody binds to Zebrafish hmces.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Zebrafish hmces Antibody is a mouse antibody against hmces. It can be used for hmces detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesZgc:165500 protein; hmce
UniProt IDA5PLB0
Protein RefseqThe length of the protein is 353 amino acids long.
The sequence is show below: MCGRTACTLAPHELSRASHYRDRTGQRRPPRWKDGDSDKYRPSYNKSPQSFSPVLLSNRHFNKDAPVDECVLAAMRWGLVPAWFKENDPNKMQYNTSNCRSESLLEKKSYKDPLLKGQRCVILADGFYEWRRQEKDKQPFFIYFPQSQGGQVPSPQSTQELKSDLELDQGESDLDTSDWTGWRLLTIAGLFDSWTPPCGGETLYTYTVITVDASPNLQSIHDRMPAVLDGEDEVRRWLDFGEVKSLEAIKLLQPKSCLTFHPVSSLVNNSRNNSPECLQPVDPTIKKSTKPTASSKMMMSWLKTASPTKRKSPDEDTSDKGPEEKPAAEKQNKPTGPLQQWLMGTSSSKKPRT.
For Research Use Only | Not For Clinical Use.
Online Inquiry