AibGenesis™ Mouse Anti-hmga1b Antibody (CBMOAB-79579FYA)


Cat: CBMOAB-79579FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-79579FYA Monoclonal Zebrafish (Danio rerio), Dog (Canis lupus familiaris) WB, ELISA MO79579FYA 100 µg
MO-AB-31128W Monoclonal Dog (Canis lupus familiaris) WB, ELISA MO31128W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio), Dog (Canis lupus familiaris)
CloneMO79579FYA
SpecificityThis antibody binds to Zebrafish hmga1b.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationNucleus; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Zebrafish hmga1b Antibody is a mouse antibody against hmga1b. It can be used for hmga1b detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesZgc:153948; hmga1b; zgc:15394
UniProt IDQ08BD1
Protein RefseqThe length of the protein is 92 amino acids long.
The sequence is show below: MSDSEKQTVSLKDKDGVEKRGRGRPRKHPKESSGSPSAKKPRGRPKGSKNKGPSKRKSSTSGSKAKGKPKKEEKEKPQDSSEDAEEDEDEEQ.
For Research Use Only | Not For Clinical Use.
Online Inquiry